dbPTM

YM46_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YM46_YEAST
UniProt AC	Q03231
Protein Name	Uncharacterized protein YMR181C
Gene Name	YMR181C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	154
Subcellular Localization
Protein Description
Protein Sequence	MTPLLQAEAKMNTSLYLTESIQQHEFNLTSPQSFYSSPSVPNSKNNSGIFSYNTANNSRVSSSDEFTTQQDGMNTIMYKNNISKTFEDDIFYCPRSLLTPEEQVVYQEIDKYYMEQALLTQLQISQTYSSTPKEEKIVKFNPYTSKSFSPASSE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MTPLLQAEA ------CCHHHHHHH	23.73	22369663
47	Phosphorylation	VPNSKNNSGIFSYNT CCCCCCCCCCEEEEC	42.53	22369663
51	Phosphorylation	KNNSGIFSYNTANNS CCCCCCEEEECCCCC	18.62	22369663
85	Phosphorylation	YKNNISKTFEDDIFY EECCCCCCCCCCCEE	26.01	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	RSP5	P39940	PMID:22199232

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YM46_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YM46_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MAK5_YEAST	MAK5	genetic	27708008
UBC3_YEAST	CDC34	genetic	27708008
TAF12_YEAST	TAF12	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
ATC7_YEAST	NEO1	genetic	27708008
ARP4_YEAST	ARP4	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
DED1_YEAST	DED1	genetic	27708008
CDC24_YEAST	CDC24	genetic	27708008
PRP6_YEAST	PRP6	genetic	27708008
TAF5_YEAST	TAF5	genetic	27708008
NSE4_YEAST	NSE4	genetic	27708008
CDC53_YEAST	CDC53	genetic	27708008
NOP14_YEAST	NOP14	genetic	27708008
RRP1_YEAST	RRP1	genetic	27708008
RLI1_YEAST	RLI1	genetic	27708008
PCF11_YEAST	PCF11	genetic	27708008
NSE3_YEAST	NSE3	genetic	27708008
RPB7_YEAST	RPB7	genetic	27708008
SAD1_YEAST	SAD1	genetic	27708008
CDC20_YEAST	CDC20	genetic	27708008
CBF3A_YEAST	CBF2	genetic	27708008
CDC23_YEAST	CDC23	genetic	27708008
MET30_YEAST	MET30	genetic	27708008
HSP77_YEAST	SSC1	genetic	27708008
NEP1_YEAST	EMG1	genetic	27708008
NBP1_YEAST	NBP1	genetic	27708008
NOP2_YEAST	NOP2	genetic	27708008
NAT10_YEAST	KRE33	genetic	27708008
SEC12_YEAST	SEC12	genetic	27708008
HRP1_YEAST	HRP1	genetic	27708008
TYSY_YEAST	CDC21	genetic	27708008
MED4_YEAST	MED4	genetic	27708008
YTM1_YEAST	YTM1	genetic	27708008
MYO2_YEAST	MYO2	genetic	27708008
PSB5_YEAST	PRE2	genetic	27708008
BUR1_YEAST	SGV1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YM46_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-2 AND SER-47, AND MASSSPECTROMETRY.	18407956 [Abstract]