dbPTM

DAP1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DAP1_YEAST
UniProt AC	Q12091
Protein Name	Damage response protein 1
Gene Name	DAP1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	152
Subcellular Localization
Protein Description
Protein Sequence	MSFIKNLLFGGVKTSEDPTGLTGNGASNTNDSNKGSEPVVAGNFFPRTLSKFNGHDDEKIFIAIRGKVYDCTRGRQFYGPSGPYTNFAGHDASRGLALNSFDLDVIKDWDQPIDPLDDLTKEQIDALDEWQEHFENKYPCIGTLIPEPGVNV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
19	Phosphorylation	VKTSEDPTGLTGNGA CCCCCCCCCCCCCCC	58.08	23607784
22	Phosphorylation	SEDPTGLTGNGASNT CCCCCCCCCCCCCCC	29.91	23607784
27	Phosphorylation	GLTGNGASNTNDSNK CCCCCCCCCCCCCCC	45.65	23607784
29	Phosphorylation	TGNGASNTNDSNKGS CCCCCCCCCCCCCCC	37.60	23607784
32	Phosphorylation	GASNTNDSNKGSEPV CCCCCCCCCCCCCCE	42.38	21440633
51	Acetylation	FFPRTLSKFNGHDDE CCCCCHHHCCCCCCC	46.06	22865919
81	Phosphorylation	GRQFYGPSGPYTNFA CCEEECCCCCCCCCC	48.30	27017623
120	Phosphorylation	IDPLDDLTKEQIDAL CCCHHHCCHHHHHHH	39.26	22369663

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DAP1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DAP1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DAP1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GUF1_YEAST	GUF1	physical	11805837
PMA1_YEAST	PMA1	physical	11805837
CP51_YEAST	ERG11	genetic	15713626
RRP1_YEAST	RRP1	physical	16554755
GLG1_YEAST	GLG1	physical	16554755
MGA2_YEAST	MGA2	genetic	16269340
PGC1_YEAST	PGC1	genetic	16269340
GIP3_YEAST	GIP3	genetic	16269340
GLO3_YEAST	GLO3	genetic	16269340
TYW1_YEAST	TYW1	genetic	16269340
ATS1_YEAST	ATS1	genetic	20093466
SRF1_YEAST	SRF1	genetic	20093466
ASK10_YEAST	ASK10	genetic	20093466
THIK_YEAST	POT1	genetic	20093466
UPS1_YEAST	UPS1	genetic	20093466
PPID_YEAST	CPR6	genetic	20093466
PUN1_YEAST	PUN1	genetic	20093466
SCS7_YEAST	SCS7	genetic	20093466
EOS1_YEAST	EOS1	genetic	20093466
ENO2_YEAST	ENO2	physical	22940862
YPT7_YEAST	YPT7	physical	17954932
PEP12_YEAST	PEP12	physical	17954932
CP51_YEAST	ERG11	physical	17954932
ASK10_YEAST	ASK10	genetic	27708008
SRN2_YEAST	SRN2	genetic	27708008
SLX5_YEAST	SLX5	genetic	27708008
MGA2_YEAST	MGA2	genetic	27708008
MRT4_YEAST	MRT4	genetic	27708008
UPS1_YEAST	UPS1	genetic	27708008
PPID_YEAST	CPR6	genetic	27708008
FKS1_YEAST	FKS1	genetic	27708008
ELP1_YEAST	IKI3	genetic	27708008
PUN1_YEAST	PUN1	genetic	27708008
UBX2_YEAST	UBX2	genetic	27708008
EOS1_YEAST	EOS1	genetic	27708008
ICE2_YEAST	ICE2	genetic	29674565
LSM1_YEAST	LSM1	genetic	29674565
TAD3_YEAST	TAD3	genetic	29674565
YPT7_YEAST	YPT7	genetic	29674565
DIA2_YEAST	DIA2	genetic	29674565
OST2_YEAST	OST2	genetic	29674565
WDR59_YEAST	MTC5	genetic	29674565

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DAP1_YEAST

Related Literatures of Post-Translational Modification