UniProt ID | YMD7_YEAST | |
---|---|---|
UniProt AC | Q03703 | |
Protein Name | Uncharacterized protein YML037C | |
Gene Name | YML037C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 340 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MDENKIIDQLFSKEYTPQDDSEQAKNGDVSLYGLLDEVANGRRLMNCLFHSPMQMGNKLSTDKLDGKCRQIQRDWIDEEKTITMNSGALQLDGPVLFSWSHNVAPTSHQETINTTFKQGSPSRGSNKPKITTTSQLFDRASAEIDKCIKPNSKSWMVEERFERNEAHTADGKKPSTWANSDFKVDPLQKFVVKELPKEKKKSDGDKTKKNKSKRKSFFGFWGHSGSKSGSKKKSEKPIEAKNEIQDEVSQKSGLSPDDDTTFSDKNTIQSKQESMSDQQAEPKVHEPAVTNTGCSEHDDGDGFEQVPAQSSYHPSSEPSIASTPSLTLDSFIPLQPKKKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
120 | Phosphorylation | NTTFKQGSPSRGSNK HCCCCCCCCCCCCCC | 19.74 | 27717283 | |
122 | Phosphorylation | TFKQGSPSRGSNKPK CCCCCCCCCCCCCCC | 51.47 | 27717283 | |
216 | Phosphorylation | KNKSKRKSFFGFWGH CCHHHCHHHEECCCC | 29.82 | 21440633 | |
224 | Phosphorylation | FFGFWGHSGSKSGSK HEECCCCCCCCCCCC | 40.60 | 24961812 | |
226 | Phosphorylation | GFWGHSGSKSGSKKK ECCCCCCCCCCCCCC | 27.02 | 24961812 | |
249 | Phosphorylation | NEIQDEVSQKSGLSP HHHHHHHHHHCCCCC | 29.82 | 22369663 | |
252 | Phosphorylation | QDEVSQKSGLSPDDD HHHHHHHCCCCCCCC | 37.01 | 22369663 | |
255 | Phosphorylation | VSQKSGLSPDDDTTF HHHHCCCCCCCCCCC | 29.79 | 22369663 | |
260 | Phosphorylation | GLSPDDDTTFSDKNT CCCCCCCCCCCCHHH | 36.41 | 22369663 | |
261 | Phosphorylation | LSPDDDTTFSDKNTI CCCCCCCCCCCHHHH | 28.30 | 22369663 | |
263 | Phosphorylation | PDDDTTFSDKNTIQS CCCCCCCCCHHHHHH | 45.65 | 22369663 | |
267 | Phosphorylation | TTFSDKNTIQSKQES CCCCCHHHHHHHHHH | 26.57 | 22369663 | |
270 | Phosphorylation | SDKNTIQSKQESMSD CCHHHHHHHHHHCCC | 32.24 | 22369663 | |
274 | Phosphorylation | TIQSKQESMSDQQAE HHHHHHHHCCCCCCC | 22.54 | 22369663 | |
276 | Phosphorylation | QSKQESMSDQQAEPK HHHHHHCCCCCCCCC | 41.36 | 22369663 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YMD7_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YMD7_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YMD7_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MNE1_YEAST | MNE1 | genetic | 27708008 | |
ATC1_YEAST | PMR1 | genetic | 27708008 | |
HUR1_YEAST | HUR1 | genetic | 27708008 | |
XRN1_YEAST | XRN1 | genetic | 27708008 | |
VMA21_YEAST | VMA21 | genetic | 27708008 | |
RS27B_YEAST | RPS27B | genetic | 27708008 | |
VPS53_YEAST | VPS53 | genetic | 27708008 | |
DAN1_YEAST | DAN1 | genetic | 27708008 | |
RL14A_YEAST | RPL14A | genetic | 27708008 | |
CTK1_YEAST | CTK1 | genetic | 27708008 | |
RL22A_YEAST | RPL22A | genetic | 27708008 | |
CHA4_YEAST | CHA4 | genetic | 27708008 | |
SPSY_YEAST | SPE4 | genetic | 27708008 | |
MMS22_YEAST | MMS22 | genetic | 27708008 | |
PET8_YEAST | PET8 | genetic | 27708008 | |
HDA1_YEAST | HDA1 | genetic | 27708008 | |
COQ2_YEAST | COQ2 | genetic | 27708008 | |
ATX2_YEAST | ATX2 | genetic | 27708008 | |
KIN4_YEAST | KIN4 | genetic | 27708008 | |
VPH1_YEAST | VPH1 | genetic | 27708008 | |
SGF11_YEAST | SGF11 | genetic | 27708008 | |
EF1G1_YEAST | CAM1 | genetic | 27708008 | |
GGPPS_YEAST | BTS1 | genetic | 27708008 | |
RL21B_YEAST | RPL21B | genetic | 27708008 | |
ELP3_YEAST | ELP3 | genetic | 27708008 | |
TGS1_YEAST | TGS1 | genetic | 27708008 | |
COX10_YEAST | COX10 | genetic | 27708008 | |
RTC6_YEAST | RTC6 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...