| UniProt ID | FUN19_YEAST | |
|---|---|---|
| UniProt AC | P28003 | |
| Protein Name | SWIRM domain-containing protein FUN19 | |
| Gene Name | FUN19 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 413 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MGLYSPESEKSQLNMNYIGKDDSQSIFRRLNQNLKASNNNNDSNKNGLNMSDYSNNSPYGRSYDVRINQNSQNNGNGCFSGSIDSLVDEHIIPSPPLSPKLESKISHNGSPRMASSVLVGSTPKGAVENVLFVKPVWPNGLSRKRYRYATYGFLSQYKIFSNLAQPYSKNIINRYNNLAYNARHKYSKYNDDMTPPPLPSSSSRLPSPLASPNLNRQARYNMRKQALYNNNLGKFESDTEWIPRKRKVYSPQRRTMTTSPHRAKKFSPSASTPHTNIASIEAIHDAPQYIPNVSWKKLPDYSPPLSTLPTDSNKSLKIEWKGSPMDLSTDPLRNELHPAELVLAQTLRLPCDLYLDSKRRLFLEKVYRLKKGLPFRRTDAQKACRIDVNKASRLFQAFEKVGWLQDSNFTKYL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MGLYSPESEKS ----CCCCCCHHHHC | 19.22 | 29136822 | |
| 5 | Phosphorylation | ---MGLYSPESEKSQ ---CCCCCCHHHHCC | 27.51 | 22369663 | |
| 11 | Phosphorylation | YSPESEKSQLNMNYI CCCHHHHCCCCCCCC | 35.53 | 28889911 | |
| 82 | Phosphorylation | GNGCFSGSIDSLVDE CCCCCCCCHHHHCCC | 23.25 | 28889911 | |
| 94 | Phosphorylation | VDEHIIPSPPLSPKL CCCCCCCCCCCCHHH | 28.83 | 28889911 | |
| 103 | Phosphorylation | PLSPKLESKISHNGS CCCHHHHHHCCCCCC | 45.80 | 24961812 | |
| 106 | Phosphorylation | PKLESKISHNGSPRM HHHHHHCCCCCCCCC | 18.03 | 28889911 | |
| 110 | Phosphorylation | SKISHNGSPRMASSV HHCCCCCCCCCCCEE | 18.04 | 27214570 | |
| 115 | Phosphorylation | NGSPRMASSVLVGST CCCCCCCCEEEECCC | 16.19 | 28889911 | |
| 116 | Phosphorylation | GSPRMASSVLVGSTP CCCCCCCEEEECCCC | 15.21 | 25752575 | |
| 122 | Phosphorylation | SSVLVGSTPKGAVEN CEEEECCCCCCCEEE | 24.08 | 25752575 | |
| 186 | Phosphorylation | AYNARHKYSKYNDDM HHHHHHCHHHCCCCC | 12.31 | 29136822 | |
| 187 | Phosphorylation | YNARHKYSKYNDDMT HHHHHCHHHCCCCCC | 33.20 | 29136822 | |
| 189 | Phosphorylation | ARHKYSKYNDDMTPP HHHCHHHCCCCCCCC | 20.20 | 29136822 | |
| 194 | Phosphorylation | SKYNDDMTPPPLPSS HHCCCCCCCCCCCCC | 39.37 | 29136822 | |
| 200 | Phosphorylation | MTPPPLPSSSSRLPS CCCCCCCCCCCCCCC | 51.00 | 24961812 | |
| 201 | Phosphorylation | TPPPLPSSSSRLPSP CCCCCCCCCCCCCCC | 30.32 | 24961812 | |
| 202 | Phosphorylation | PPPLPSSSSRLPSPL CCCCCCCCCCCCCCC | 24.66 | 24961812 | |
| 203 | Phosphorylation | PPLPSSSSRLPSPLA CCCCCCCCCCCCCCC | 39.52 | 24961812 | |
| 207 | Phosphorylation | SSSSRLPSPLASPNL CCCCCCCCCCCCCCC | 36.82 | 21082442 | |
| 211 | Phosphorylation | RLPSPLASPNLNRQA CCCCCCCCCCCCHHH | 23.23 | 25752575 | |
| 220 | Phosphorylation | NLNRQARYNMRKQAL CCCHHHHHHHHHHHH | 19.14 | 24961812 | |
| 237 | Phosphorylation | NNLGKFESDTEWIPR CCCCCCCCCCCCCCC | 53.62 | 29136822 | |
| 239 | Phosphorylation | LGKFESDTEWIPRKR CCCCCCCCCCCCCCC | 42.36 | 24961812 | |
| 255 | Phosphorylation | VYSPQRRTMTTSPHR CCCCCCCCCCCCHHH | 22.51 | 28889911 | |
| 257 | Phosphorylation | SPQRRTMTTSPHRAK CCCCCCCCCCHHHHH | 24.41 | 19779198 | |
| 258 | Phosphorylation | PQRRTMTTSPHRAKK CCCCCCCCCHHHHHC | 29.46 | 17563356 | |
| 259 | Phosphorylation | QRRTMTTSPHRAKKF CCCCCCCCHHHHHCC | 15.00 | 29136822 | |
| 267 | Phosphorylation | PHRAKKFSPSASTPH HHHHHCCCCCCCCCC | 27.16 | 24961812 | |
| 269 | Phosphorylation | RAKKFSPSASTPHTN HHHCCCCCCCCCCCC | 33.38 | 24961812 | |
| 271 | Phosphorylation | KKFSPSASTPHTNIA HCCCCCCCCCCCCCC | 46.97 | 24961812 | |
| 272 | Phosphorylation | KFSPSASTPHTNIAS CCCCCCCCCCCCCCC | 20.85 | 24961812 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FUN19_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FUN19_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FUN19_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-5; SER-82; SER-94;SER-116; THR-122; THR-194; SER-207 AND SER-211, AND MASS SPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-258, AND MASSSPECTROMETRY. | |
