APC4_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: APC4_YEAST
• UniProt AC: Q04601
• Protein Name: Anaphase-promoting complex subunit 4
• Gene Name: APC4
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 652
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Description: Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C is thought to confer substrate specificity and, in the presence of ubiquitin-conjugating E2 enzymes, it catalyzes the formation of protein-ubiquitin conjugates that are subsequently degraded by the 26S proteasome. In early mitosis, the APC/C is activated by CDC20 and targets securin PDS1, the B-type cyclin CLB5, and other anaphase inhibitory proteins for proteolysis, thereby triggering the separation of sister chromatids at the metaphase-to-anaphase transition. In late mitosis and in G1, degradation of CLB5 allows activation of the APC/C by CDH1, which is needed to destroy CDC20 and the B-type cyclin CLB2 to allow exit from mitosis and creating the low CDK state necessary for cytokinesis and for reforming prereplicative complexes in G1 prior to another round of replication..
• Protein Sequence: MSSPINDYFIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGKFLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTKISKGIWDRIPLRYEPNNRDFACNIIDDLPKLIRFVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEKLDVHVVFNEGNDKITVFFNGDYAVFLSVDNIENENSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLLNYIMVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYGKLKSELEALFLLGEISCDLEDWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAFSIQNKLSYTSDLTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDEDYKLKFQFEDDLYFGYDLLSYFDRILSKKGTEPSSIIDVKLYRDLINSMSDMEKDIAQSNVNSHIQQHILVDLKTDVFAQKYPSSQINLLDAIKLPKHNYIVYLIQVTKHNSAQEPFSEENKKKLYIGTLKDENLGIISKESSVKIPALFKSYRLSSTRFVPNRVHSLLRDIGLSDSNYHSSHVTDYRGENYENEEDDGTIAIPAYIRENRENDDFIACTAKVSVDGRSASLVFPKEKQNV

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
3	Phosphorylation	-----MSSPINDYFI -----CCCCCCCCCC	28.62	28889911
8	Phosphorylation	MSSPINDYFIDYNPL CCCCCCCCCCCCCCC	9.65	28889911
12	Phosphorylation	INDYFIDYNPLFPIF CCCCCCCCCCCHHHH	17.54	28889911
21	Phosphorylation	PLFPIFATRIAKGLA CCHHHHHHHHHHCCE	16.32	28889911
92	Acetylation	FLRIPSTKISKGIWD EEEECCCCCCCCCHH	49.69	24489116
442	Phosphorylation	RILSKKGTEPSSIID HHHHCCCCCCCCCCC	54.31	27214570
523	Phosphorylation	IQVTKHNSAQEPFSE EEECCCCCCCCCCCH	30.92	30377154
568	Phosphorylation	FKSYRLSSTRFVPNR HCEECCCCCCCCCHH	28.35	19779198
569	Phosphorylation	KSYRLSSTRFVPNRV CEECCCCCCCCCHHH	25.42	19779198
640	Phosphorylation	KVSVDGRSASLVFPK EEEECCCEEEEECCH	27.95	27017623

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of APC4_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of APC4_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of APC4_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDC16_YEAST	CDC16	physical	15060174
SWM1_YEAST	SWM1	physical	15060174
APC2_YEAST	APC2	physical	15060174
APC1_YEAST	APC1	physical	15060174
APC4_YEAST	APC4	physical	15060174
CDC27_YEAST	CDC27	physical	15060174
APC5_YEAST	APC5	physical	15060174
CDC23_YEAST	CDC23	physical	15060174
MND2_YEAST	MND2	physical	15060174
APC9_YEAST	APC9	physical	15060174
APC10_YEAST	DOC1	physical	15060174
APC11_YEAST	APC11	physical	15060174
CDC26_YEAST	CDC26	physical	15060174
SWM1_YEAST	SWM1	physical	12477395
MND2_YEAST	MND2	physical	12477395
APC1_YEAST	APC1	physical	12477395
APC2_YEAST	APC2	physical	12477395
CDC27_YEAST	CDC27	physical	12477395
APC4_YEAST	APC4	physical	12477395
APC5_YEAST	APC5	physical	12477395
CDC16_YEAST	CDC16	physical	12477395
CDC23_YEAST	CDC23	physical	12477395
APC9_YEAST	APC9	physical	12477395
APC10_YEAST	DOC1	physical	12477395
APC11_YEAST	APC11	physical	12477395
CDC26_YEAST	CDC26	physical	12477395
CDC27_YEAST	CDC27	physical	9469814
APC9_YEAST	APC9	physical	9469814
APC10_YEAST	DOC1	physical	9469814
CDC23_YEAST	CDC23	physical	16554755
APC9_YEAST	APC9	physical	16554755
ECM13_YEAST	ECM13	physical	17634282
KAR4_YEAST	KAR4	physical	17634282
SNF1_YEAST	SNF1	physical	17634282
AAKG_YEAST	SNF4	physical	17634282
FZF1_YEAST	FZF1	physical	17634282
CDC23_YEAST	CDC23	physical	17634282
DUS3_YEAST	DUS3	physical	17634282
YM17_YEAST	ERG29	physical	17634282
APC5_YEAST	APC5	physical	17634282
RLF2_YEAST	RLF2	physical	17634282
APC1_YEAST	APC1	physical	21186364
APC2_YEAST	APC2	physical	21186364
CDC16_YEAST	CDC16	physical	21186364
CDC27_YEAST	CDC27	physical	21186364
APC5_YEAST	APC5	physical	21186364
CDC23_YEAST	CDC23	physical	21186364
MND2_YEAST	MND2	physical	21186364
APC9_YEAST	APC9	physical	21186364
APC10_YEAST	DOC1	physical	21186364
APC11_YEAST	APC11	physical	21186364
APC5_YEAST	APC5	physical	21307936

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.