YJ9K_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YJ9K_YEAST
• UniProt AC: P47174
• Protein Name: Uncharacterized protein YJR146W
• Gene Name: YJR146W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 117
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Sequence: MKVGKAKKKPEIFSAHCSVATAFLDPSFFYPNFVAQKASHYNDKTGSANIWTYISRTGSLLLFTQVVYRKSKWTHQSATFADCIYCQSGQSPSVSLSCSDARQTWMQHRGWSSLMSL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
71	Phosphorylation	TQVVYRKSKWTHQSA EEEEECCCCCCCCCC	25.16	28747907
79	Phosphorylation	KWTHQSATFADCIYC CCCCCCCEEECEEEE	25.30	28747907
85	Phosphorylation	ATFADCIYCQSGQSP CEEECEEEECCCCCC	7.26	28747907
88	Phosphorylation	ADCIYCQSGQSPSVS ECEEEECCCCCCCEE	34.93	28747907
91	Phosphorylation	IYCQSGQSPSVSLSC EEECCCCCCCEEEEC	23.75	28747907
93	Phosphorylation	CQSGQSPSVSLSCSD ECCCCCCCEEEECHH	29.59	28747907
95	Phosphorylation	SGQSPSVSLSCSDAR CCCCCCEEEECHHHH	20.92	28747907
97	Phosphorylation	QSPSVSLSCSDARQT CCCCEEEECHHHHHH	12.22	28747907
99	Phosphorylation	PSVSLSCSDARQTWM CCEEEECHHHHHHHH	30.81	28747907

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YJ9K_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YJ9K_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YJ9K_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YJ9K_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.