| UniProt ID | YG3L_YEAST | |
|---|---|---|
| UniProt AC | P48236 | |
| Protein Name | Uncharacterized membrane protein YGR149W | |
| Gene Name | YGR149W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 432 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
| Protein Description | ||
| Protein Sequence | MYKLDNNDIDDETNNSVSLTSLLEFLDPIASKVVSKYYHGSHLSKAEQKLRNFEGFRRRKPHHEHDSHHPHHLNRSRSFLQLEDFKVRALQRIRNLDKPLDSIFFKNSSRLEKAFYPFTLFNIFFIGFLMGRFPEWFHVYYTILFFVLMPIRFYTYYKTKNHYFLADFCYFVNMLCLLFIWIFPYSYSLFQSCFAFTFGTLCFAVITWRNSLVIHSIDKTTSCFIHIIPPCVMYVIYHGLPLEYKIERFPGAIIQSELDIKKNILWTSLYYLVWQSLYHYFITLKKSSKIKSGERMTSFEYLTTHQFKNFWAVKLRSPWPMIIYTLSQYFYQLFTMLLCGIWIRYKLAAALFLTIVFLWASHNGATYYIDHYGKNFEKEVDRLRLEVENLQQKLQPDSDAVISDASVNDKDYLNVNRDEDFDDSSSVSSKSD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 98 | Acetylation | QRIRNLDKPLDSIFF HHHHCCCCCCCCCCC | 51.12 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YG3L_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YG3L_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YG3L_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-76 AND SER-78, AND MASSSPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-76 AND SER-78, AND MASSSPECTROMETRY. | |
| "Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-78, AND MASSSPECTROMETRY. | |