| UniProt ID | PAU24_YEAST | |
|---|---|---|
| UniProt AC | P38155 | |
| Protein Name | Seripauperin-24 | |
| Gene Name | PAU24 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 120 | |
| Subcellular Localization | Secreted, cell wall. | |
| Protein Description | Component of the cell wall.. | |
| Protein Sequence | MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYSFQVAHPTETYPVEIAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of PAU24_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU24_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU24_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU24_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| RL6B_YEAST | RPL6B | genetic | 27708008 | |
| RAD1_YEAST | RAD1 | genetic | 27708008 | |
| MPS1_YEAST | MPS1 | genetic | 27708008 | |
| PRP9_YEAST | PRP9 | genetic | 27708008 | |
| RPB7_YEAST | RPB7 | genetic | 27708008 | |
| SSL1_YEAST | SSL1 | genetic | 27708008 | |
| SED5_YEAST | SED5 | genetic | 27708008 | |
| YJY1_YEAST | YJR011C | genetic | 27708008 | |
| CTK1_YEAST | CTK1 | genetic | 27708008 | |
| TSA1_YEAST | TSA1 | genetic | 27708008 | |
| RAD52_YEAST | RAD52 | genetic | 27708008 | |
| GBLP_YEAST | ASC1 | genetic | 27708008 | |
| GYL1_YEAST | GYL1 | genetic | 27708008 | |
| DGK1_YEAST | DGK1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...