UniProt ID | PAU24_YEAST | |
---|---|---|
UniProt AC | P38155 | |
Protein Name | Seripauperin-24 | |
Gene Name | PAU24 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 120 | |
Subcellular Localization | Secreted, cell wall. | |
Protein Description | Component of the cell wall.. | |
Protein Sequence | MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRAHLAQYYSFQVAHPTETYPVEIAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PAU24_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAU24_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAU24_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAU24_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ACT_YEAST | ACT1 | genetic | 27708008 | |
RL6B_YEAST | RPL6B | genetic | 27708008 | |
RAD1_YEAST | RAD1 | genetic | 27708008 | |
MPS1_YEAST | MPS1 | genetic | 27708008 | |
PRP9_YEAST | PRP9 | genetic | 27708008 | |
RPB7_YEAST | RPB7 | genetic | 27708008 | |
SSL1_YEAST | SSL1 | genetic | 27708008 | |
SED5_YEAST | SED5 | genetic | 27708008 | |
YJY1_YEAST | YJR011C | genetic | 27708008 | |
CTK1_YEAST | CTK1 | genetic | 27708008 | |
TSA1_YEAST | TSA1 | genetic | 27708008 | |
RAD52_YEAST | RAD52 | genetic | 27708008 | |
GBLP_YEAST | ASC1 | genetic | 27708008 | |
GYL1_YEAST | GYL1 | genetic | 27708008 | |
DGK1_YEAST | DGK1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...