| UniProt ID | YNT4_YEAST | |
|---|---|---|
| UniProt AC | P40169 | |
| Protein Name | Uncharacterized plasma membrane protein YNL194C | |
| Gene Name | YNL194C | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 301 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein . |
|
| Protein Description | Involved in sporulation and affects the sphingolipid composition of the plasma membrane.. | |
| Protein Sequence | MSYKKFVYFINLFFLLGATLLTFFLILAGGRTTGVLKNFYWFQASTSGFNSAPSVTRWYNYNWCGWESRGIAVNCSSKMAAQPFSPRDNFGSSPLMPSTFLNNRNAYYYLSRVGWAMLLIGLFFLLITLVSVIASLIRYNRRTAALATAMSWITLFFITLSACLYTGCYAKAVKAFHHENRDARLGPKNFGLIWTTVFLLIVNAICCTIMVATHKRNEYIYDRSFASTKTVDSQTPTPVPTNGGIPSSVPVTEVQQSQSHQNHRFFKKLRTKKRTVTSAGDEPDRVQEERVYTEQNVPVVS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 224 | Phosphorylation | NEYIYDRSFASTKTV CCCCCCCCCCCCEEC | 23.44 | 27214570 | |
| 230 | Phosphorylation | RSFASTKTVDSQTPT CCCCCCEECCCCCCC | 29.63 | 29136822 | |
| 233 | Phosphorylation | ASTKTVDSQTPTPVP CCCEECCCCCCCCCC | 31.45 | 29136822 | |
| 235 | Phosphorylation | TKTVDSQTPTPVPTN CEECCCCCCCCCCCC | 32.84 | 29136822 | |
| 237 | Phosphorylation | TVDSQTPTPVPTNGG ECCCCCCCCCCCCCC | 40.06 | 29136822 | |
| 241 | Phosphorylation | QTPTPVPTNGGIPSS CCCCCCCCCCCCCCC | 46.89 | 21440633 | |
| 247 | Phosphorylation | PTNGGIPSSVPVTEV CCCCCCCCCCCCCCC | 41.89 | 24961812 | |
| 248 | Phosphorylation | TNGGIPSSVPVTEVQ CCCCCCCCCCCCCCC | 25.70 | 24961812 | |
| 252 | Phosphorylation | IPSSVPVTEVQQSQS CCCCCCCCCCCCCCC | 25.11 | 24961812 | |
| 275 | Phosphorylation | KLRTKKRTVTSAGDE HHHHCCCEECCCCCC | 36.69 | 29136822 | |
| 277 | Phosphorylation | RTKKRTVTSAGDEPD HHCCCEECCCCCCCC | 16.55 | 29136822 | |
| 278 | Phosphorylation | TKKRTVTSAGDEPDR HCCCEECCCCCCCCC | 26.39 | 29136822 | |
| 293 | Phosphorylation | VQEERVYTEQNVPVV CCCCCEECCCCCCCC | 28.39 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YNT4_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YNT4_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YNT4_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...