dbPTM

OAZ_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OAZ_YEAST
UniProt AC	Q02803
Protein Name	Ornithine decarboxylase antizyme
Gene Name	OAZ1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	292
Subcellular Localization
Protein Description	Ornithine decarboxylase (ODC) antizyme protein that negatively regulates ODC activity and intracellular polyamine biosynthesis in response to increased intracellular polyamine levels. [PubMed: 15538383 Binds to ODC/SPE1 monomers, inhibiting the assembly of the functional ODC homodimer, and targets the monomers for ubiquitin-independent proteolytic destruction by the 26S proteasome]
Protein Sequence	MYEVIQKRKTKIINVLQSPELMRLIEDPSNLGISLHFPVSSLLKSNKCTPMPKLSTYSLASGGFKDWCADIPLDVPPEIDIIDFYWDVILCMESQFILDYNVPSKNKGNNQKSVAKLLKNKLVNDMKTTLKRLIYNENTKQYKNNNSHDGYNWRKLGSQYFILYLPLFTQELIWCKLNENYFHVVLPSLLNSRNVHDNHSTYINKDWLLALLELTSNLNQNFKFEYMKLRLYILRDDLINNGLDLLKNLNWVGGKLIKNEDREVLLNSTDLATDSISHLLGDENFVILEFEC

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
140	Ubiquitination	LIYNENTKQYKNNNS HHCCCCCCCCCCCCC	64.31	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OAZ_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OAZ_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OAZ_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DCOR_YEAST	SPE1	physical	18089576
DCOR_YEAST	SPE1	physical	21295581
DCOR_YEAST	SPE1	physical	21295540
ATC3_YEAST	DRS2	genetic	27708008
GFD2_YEAST	GFD2	genetic	27708008
ENV10_YEAST	ENV10	genetic	27708008
RL36A_YEAST	RPL36A	genetic	29158977
DOM34_YEAST	DOM34	genetic	29158977

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OAZ_YEAST

Related Literatures of Post-Translational Modification