dbPTM

YL050_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YL050_YEAST
UniProt AC	Q12155
Protein Name	Uncharacterized membrane protein YLR050C
Gene Name	YLR050C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	161
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description
Protein Sequence	MKLGHREQQFYLWYFIVHIPITIFIDSSVVIPAKWQLGIAQKVVSDHIAKQHDFLLSEKPEWLYWFVVLELVLQLPLFVYFVNKFWNSSELQVNTNSRLKKWLRIYGWNASLTTLICIVVIFKRGYIPYDVLKTSLSMTQKCQLASVYLPTFLIPLRLCFV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
106	Phosphorylation	LKKWLRIYGWNASLT HHHHHHHHCCCCHHH	15.06	26447709
111	Phosphorylation	RIYGWNASLTTLICI HHHCCCCHHHHHHHH	24.04	26447709
113	Phosphorylation	YGWNASLTTLICIVV HCCCCHHHHHHHHHH	19.63	26447709
114	Phosphorylation	GWNASLTTLICIVVI CCCCHHHHHHHHHHH	21.30	26447709

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YL050_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YL050_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YL050_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
IZH3_YEAST	IZH3	genetic	16269340
TRS20_YEAST	TRS20	genetic	16269340
UBC6_YEAST	UBC6	genetic	16269340
RFS1_YEAST	RFS1	genetic	20093466
MBA1_YEAST	MBA1	genetic	20093466
ATC1_YEAST	PMR1	genetic	20093466
MON1_YEAST	MON1	genetic	20093466
MPC1_YEAST	MPC1	genetic	20093466
SLX9_YEAST	SLX9	genetic	20093466
HTD2_YEAST	HTD2	genetic	20093466
COX23_YEAST	COX23	genetic	20093466
MRX5_YEAST	YJL147C	genetic	20093466
MOG1_YEAST	MOG1	genetic	20093466
CBT1_YEAST	CBT1	genetic	20093466
RM49_YEAST	MRP49	genetic	20093466
HAP4_YEAST	HAP4	genetic	20093466
PET10_YEAST	PET10	genetic	20093466
COA4_YEAST	COA4	genetic	20093466
LIPB_YEAST	LIP2	genetic	20093466
YMD8_YEAST	YMD8	genetic	20093466
USA1_YEAST	USA1	genetic	20093466
UNG_YEAST	UNG1	genetic	20093466
GIS4_YEAST	GIS4	genetic	20093466
MGR3_YEAST	MGR3	genetic	20093466
JLP2_YEAST	JLP2	genetic	20093466
ALDH3_YEAST	ALD3	genetic	20093466
RL36A_YEAST	RPL36A	genetic	20093466
TEP1_YEAST	TEP1	genetic	20093466
CY1_YEAST	CYT1	genetic	20093466
COX10_YEAST	COX10	genetic	20093466
QCR2_YEAST	QCR2	genetic	20093466
SLA1_YEAST	SLA1	genetic	21987634
CSG2_YEAST	CSG2	genetic	21987634
BEM1_YEAST	BEM1	genetic	21987634
TRS20_YEAST	TRS20	genetic	21987634
VPS54_YEAST	VPS54	genetic	21987634
MS116_YEAST	MSS116	genetic	21987634
ZUO1_YEAST	ZUO1	genetic	21987634
PTK2_YEAST	PTK2	genetic	21987634
IZH3_YEAST	IZH3	genetic	21987634
CYK2_YEAST	HOF1	genetic	21987634
IPYR2_YEAST	PPA2	genetic	21987634
H2AZ_YEAST	HTZ1	genetic	21987634
DPOG_YEAST	MIP1	genetic	21987634
NIP80_YEAST	NIP100	genetic	21987634
GIS4_YEAST	GIS4	genetic	27708008
ALDH3_YEAST	ALD3	genetic	27708008
MBA1_YEAST	MBA1	genetic	27708008
ELO2_YEAST	ELO2	genetic	27708008
MTU1_YEAST	SLM3	genetic	27708008
SWF1_YEAST	SWF1	genetic	27708008
CEM1_YEAST	CEM1	genetic	27708008
MON1_YEAST	MON1	genetic	27708008
ATC1_YEAST	PMR1	genetic	27708008
QCR9_YEAST	QCR9	genetic	27708008
HTD2_YEAST	HTD2	genetic	27708008
LPLA_YEAST	AIM22	genetic	27708008
MRX5_YEAST	YJL147C	genetic	27708008
MOG1_YEAST	MOG1	genetic	27708008
CBT1_YEAST	CBT1	genetic	27708008
VPS51_YEAST	VPS51	genetic	27708008
PET10_YEAST	PET10	genetic	27708008
COA4_YEAST	COA4	genetic	27708008
LIPB_YEAST	LIP2	genetic	27708008
USA1_YEAST	USA1	genetic	27708008
RCO1_YEAST	RCO1	genetic	27708008
GAS1_YEAST	GAS1	genetic	27708008
RAS2_YEAST	RAS2	genetic	27708008
TEP1_YEAST	TEP1	genetic	27708008
COX10_YEAST	COX10	genetic	27708008
QCR2_YEAST	QCR2	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YL050_YEAST

Related Literatures of Post-Translational Modification