UniProt ID | JLP2_YEAST | |
---|---|---|
UniProt AC | P40206 | |
Protein Name | Protein JLP2 | |
Gene Name | JLP2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 208 | |
Subcellular Localization | Cytoplasm . | |
Protein Description | ||
Protein Sequence | MVYFYESKPTEYSTPYQIVMGKDKFENDLLIKWSYRELNYVWFHADKYSSGHVYLKLRPNEKTIDDIPQEVICDCLQLCKSESIQGNKMPQCTILITPWHNLRKNRYMNPGEVSFKSLRQCRKMECGARDNKILNRLAKTRVELFNNVEATLNEAKKTKNGDFFVNYIESNRSNLIEEEKLRKVAKKNQKKKNKQSKDEVTDDMQLEV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Acetylation | QIVMGKDKFENDLLI EEEECCCCCCCCEEE | 59.05 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JLP2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JLP2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JLP2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SEC7_YEAST | SEC7 | genetic | 27708008 | |
HIR1_YEAST | HIR1 | genetic | 27708008 | |
SHG1_YEAST | SHG1 | genetic | 27708008 | |
TFS2_YEAST | DST1 | genetic | 27708008 | |
RL8A_YEAST | RPL8A | genetic | 27708008 | |
PET8_YEAST | PET8 | genetic | 27708008 | |
ESS1_YEAST | ESS1 | genetic | 27708008 | |
ORC1_YEAST | ORC1 | genetic | 27708008 | |
SNF11_YEAST | SNF11 | genetic | 27708008 | |
HNT2_YEAST | HNT2 | genetic | 27708008 | |
MIC19_YEAST | MIC19 | genetic | 27708008 | |
HOS4_YEAST | HOS4 | genetic | 27708008 | |
RE107_YEAST | REC107 | genetic | 27708008 | |
CBF1_YEAST | CBF1 | genetic | 27708008 | |
VPS24_YEAST | VPS24 | genetic | 27708008 | |
MIC60_YEAST | MIC60 | genetic | 27708008 | |
FMP46_YEAST | FMP46 | genetic | 27708008 | |
FAP1_YEAST | FAP1 | genetic | 27708008 | |
MSH2_YEAST | MSH2 | genetic | 27708008 | |
LGE1_YEAST | LGE1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...