| UniProt ID | JLP2_YEAST | |
|---|---|---|
| UniProt AC | P40206 | |
| Protein Name | Protein JLP2 | |
| Gene Name | JLP2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 208 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | ||
| Protein Sequence | MVYFYESKPTEYSTPYQIVMGKDKFENDLLIKWSYRELNYVWFHADKYSSGHVYLKLRPNEKTIDDIPQEVICDCLQLCKSESIQGNKMPQCTILITPWHNLRKNRYMNPGEVSFKSLRQCRKMECGARDNKILNRLAKTRVELFNNVEATLNEAKKTKNGDFFVNYIESNRSNLIEEEKLRKVAKKNQKKKNKQSKDEVTDDMQLEV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 24 | Acetylation | QIVMGKDKFENDLLI EEEECCCCCCCCEEE | 59.05 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of JLP2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of JLP2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of JLP2_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| SEC7_YEAST | SEC7 | genetic | 27708008 | |
| HIR1_YEAST | HIR1 | genetic | 27708008 | |
| SHG1_YEAST | SHG1 | genetic | 27708008 | |
| TFS2_YEAST | DST1 | genetic | 27708008 | |
| RL8A_YEAST | RPL8A | genetic | 27708008 | |
| PET8_YEAST | PET8 | genetic | 27708008 | |
| ESS1_YEAST | ESS1 | genetic | 27708008 | |
| ORC1_YEAST | ORC1 | genetic | 27708008 | |
| SNF11_YEAST | SNF11 | genetic | 27708008 | |
| HNT2_YEAST | HNT2 | genetic | 27708008 | |
| MIC19_YEAST | MIC19 | genetic | 27708008 | |
| HOS4_YEAST | HOS4 | genetic | 27708008 | |
| RE107_YEAST | REC107 | genetic | 27708008 | |
| CBF1_YEAST | CBF1 | genetic | 27708008 | |
| VPS24_YEAST | VPS24 | genetic | 27708008 | |
| MIC60_YEAST | MIC60 | genetic | 27708008 | |
| FMP46_YEAST | FMP46 | genetic | 27708008 | |
| FAP1_YEAST | FAP1 | genetic | 27708008 | |
| MSH2_YEAST | MSH2 | genetic | 27708008 | |
| LGE1_YEAST | LGE1 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...