| UniProt ID | RIF2_YEAST | |
|---|---|---|
| UniProt AC | Q06208 | |
| Protein Name | Protein RIF2 | |
| Gene Name | RIF2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 395 | |
| Subcellular Localization | Nucleus. Chromosome, telomere. | |
| Protein Description | Involved in transcriptional silencing and telomere length regulation. Its role in telomere length regulation results from either a block in elongation or promoting degradation of the telomere ends. Loss of RIF1 function results in derepression of an HMR silencer, whose ARS consensus element has been deleted, and in the elongation of telomeres. RAP1 may target the binding of RIF1 to silencers and telomeres.. | |
| Protein Sequence | MEHVDSDFAPIRRSKKVVDSDKIVKAISDDLEQKNFTVLRKLNLVPIKKSVSSPKVCKPSPVKERVDHVFYQKFKSMALQELGTNYLSISYVPSLSKFLSKNLRSMKNCIVFFDKVEHIHQYAGIDRAVSETLSLVDINVVIIEMNDYLMKEGIQSSKSKECIESMGQASYSGQLDFEASEKPSNHTSDLMMMVMRKINNDESIDHIVYFKFEQLDKLSTSTIIEPSKLTEFINVLSVLEKSNNIAFKVLIYSNNVSISSLLSTSLKKKLNTKYTVFEMPILTCAQEQEYLKKMIKFTFDSGSKLLQSYNSLVTCQLNNKESNLAIFFEFLKVFPHPFTYLFNAYTEIIVQSRTFDELLDKIRNRLTIKNYPHSAYNFKKNQRLPLKLTRKVHDR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Phosphorylation | DFAPIRRSKKVVDSD CCCCCCCCCCCCCHH | 27.29 | 30377154 | |
| 20 | Phosphorylation | RSKKVVDSDKIVKAI CCCCCCCHHHHHHHH | 29.24 | 28889911 | |
| 28 | Phosphorylation | DKIVKAISDDLEQKN HHHHHHHCHHHHHCC | 29.90 | 30377154 | |
| 76 | Phosphorylation | VFYQKFKSMALQELG HHHHHHHHHHHHHHC | 16.66 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIF2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIF2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIF2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
