UniProt ID | YL042_YEAST | |
---|---|---|
UniProt AC | Q07990 | |
Protein Name | Cell wall protein YLR042C | |
Gene Name | YLR042C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 161 | |
Subcellular Localization |
Secreted, cell wall . Membrane Lipid-anchor, GPI-anchor . |
|
Protein Description | ||
Protein Sequence | MKISQFGSLAFAPIVLLQLFIVQAQLLTDSNAQDLNTALGQKVQYTFLDTGNSNDQLLHLPSTTSSSIITGSLAAANFTGSSSSSSIPKVTSSVITSINYQSSNSTVVTQFTPLPSSSRNETKSSQTTNTISSSTSTGGVGSVKPCLYFVLMLETIAYLFS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
77 | N-linked_Glycosylation | TGSLAAANFTGSSSS CCCEEEECCCCCCCC | 30.22 | - | |
104 | N-linked_Glycosylation | SINYQSSNSTVVTQF EEEEECCCCEEEEEE | 47.12 | - | |
116 | Phosphorylation | TQFTPLPSSSRNETK EEEEECCCCCCCCCC | 48.94 | 27017623 | |
120 | N-linked_Glycosylation | PLPSSSRNETKSSQT ECCCCCCCCCCCCEE | 64.34 | - | |
139 | GPI-anchor | SSSTSTGGVGSVKPC CCCCCCCCCCCHHHH | 22.24 | - | |
158 | Phosphorylation | LMLETIAYLFS---- HHHHHHHHHHC---- | 12.39 | 28132839 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YL042_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YL042_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YL042_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DEP1_YEAST | DEP1 | genetic | 20093466 | |
PUS2_YEAST | PUS2 | genetic | 20093466 | |
YHK5_YEAST | YHR045W | genetic | 20093466 | |
MSB4_YEAST | MSB4 | genetic | 20093466 | |
RU2A_YEAST | LEA1 | genetic | 20093466 | |
RV161_YEAST | RVS161 | genetic | 27708008 | |
RV167_YEAST | RVS167 | genetic | 27708008 | |
THIK_YEAST | POT1 | genetic | 27708008 | |
MSB4_YEAST | MSB4 | genetic | 27708008 | |
RU2A_YEAST | LEA1 | genetic | 27708008 | |
ATG41_YEAST | ICY2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...