dbPTM

PUS2_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PUS2_YEAST
UniProt AC	P53167
Protein Name	tRNA pseudouridine(27/28) synthase
Gene Name	PUS2
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	370
Subcellular Localization	Mitochondrion .
Protein Description	Mitochondrial-specific pseudouridine synthase catalyzing the formation of pseudouridine at positions 27 and 28 in the anticodon stem and loop of mitochondrial transfer RNAs..
Protein Sequence	MLLGYCGSGYYGMQYNPPHKTIEGEILTKLFDVGAISEENSLAPKKNSFMAAARTDKGVHAMLNLLSLKITLREDTVAKLNAALPPEIRVWGIQPVNKKFNARSACDSRWYQYLIPEFILIGPPRSSLLHRNVGGCYREDGSQEVWDTFLEQTRGRFSGDELCRLQDTAQKLSESDPLVQDYVGLLSGTLSGYCLSPSKLDAFEAAMQEYVGTHNFHNFTTGKLWGDPSAQRHIKKVVVSQASPGWICVRIHGQSFMLHQIRRMVALAVLAARCQLPPNIVRNYFNAGPRKYIPRAPAQGLLLEGPVFDGYNTKLRNLLYCEIRPDDITLERMCRFRERQICTAIAHEETQRHVFCHFVRQMNRLATPLI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
199	Ubiquitination	GYCLSPSKLDAFEAA CEECCHHHHHHHHHH	54.49	19722269

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PUS2_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PUS2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PUS2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ARC1_YEAST	ARC1	genetic	19061648
CAK1_YEAST	CAK1	genetic	19061648
EF1A_YEAST	TEF2	genetic	19061648
SAP30_YEAST	SAP30	genetic	19061648
MOB2_YEAST	MOB2	genetic	27708008
NAB3_YEAST	NAB3	genetic	27708008
DPOA2_YEAST	POL12	genetic	27708008
CDK1_YEAST	CDC28	genetic	27708008
KRR1_YEAST	KRR1	genetic	27708008
CDC10_YEAST	CDC10	genetic	27708008
YRB1_YEAST	YRB1	genetic	27708008
PDC2_YEAST	PDC2	genetic	27708008
TFB1_YEAST	TFB1	genetic	27708008
SMT3_YEAST	SMT3	genetic	27708008
PANK_YEAST	CAB1	genetic	27708008
OKP1_YEAST	OKP1	genetic	27708008
SYYC_YEAST	TYS1	genetic	27708008
DNA2_YEAST	DNA2	genetic	27708008
MOB1_YEAST	MOB1	genetic	27708008
ESS1_YEAST	ESS1	genetic	27708008
KTHY_YEAST	CDC8	genetic	27708008
RFC2_YEAST	RFC2	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
PRP19_YEAST	PRP19	genetic	27708008
NSE1_YEAST	NSE1	genetic	27708008
TAD3_YEAST	TAD3	genetic	27708008
POB3_YEAST	POB3	genetic	27708008
LCB1_YEAST	LCB1	genetic	27708008
NOP2_YEAST	NOP2	genetic	27708008
PSA4_YEAST	PRE6	genetic	27708008
SGT1_YEAST	SGT1	genetic	27708008
DYR_YEAST	DFR1	genetic	27708008
SEC63_YEAST	SEC63	genetic	27708008
BUR1_YEAST	SGV1	genetic	27708008
ICE2_YEAST	ICE2	genetic	27708008
CWP2_YEAST	CWP2	genetic	27708008
FEN1_YEAST	RAD27	genetic	27708008
VPS9_YEAST	VPS9	genetic	27708008
SCS7_YEAST	SCS7	genetic	27708008
SIN3_YEAST	SIN3	genetic	27708008
ASNS1_YEAST	ASN1	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PUS2_YEAST

Related Literatures of Post-Translational Modification