UniProt ID | DNAL4_HUMAN | |
---|---|---|
UniProt AC | O96015 | |
Protein Name | Dynein light chain 4, axonemal | |
Gene Name | DNAL4 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 105 | |
Subcellular Localization | Cytoplasm, cytoskeleton, cilium axoneme. | |
Protein Description | Force generating protein of respiratory cilia. Produces force towards the minus ends of microtubules. Dynein has ATPase activity (By similarity).. | |
Protein Sequence | MGETEGKKDEADYKRLQTFPLVRHSDMPEEMRVETMELCVTACEKFSNNNESAAKMIKETMDKKFGSSWHVVIGEGFGFEITHEVKNLLYLYFGGTLAVCVWKCS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DNAL4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DNAL4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DNAL4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
DYL2_HUMAN | DYNLL2 | physical | 16189514 | |
SCTR_HUMAN | SCTR | physical | 21988832 | |
GPBP1_HUMAN | GPBP1 | physical | 21988832 | |
TRI54_HUMAN | TRIM54 | physical | 25416956 | |
DYL2_HUMAN | DYNLL2 | physical | 25416956 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 | |
FHL5_HUMAN | FHL5 | physical | 21516116 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...