UniProt ID | PYRX_YEAST | |
---|---|---|
UniProt AC | P30402 | |
Protein Name | Orotate phosphoribosyltransferase 2 | |
Gene Name | URA10 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 227 | |
Subcellular Localization | ||
Protein Description | Catalyzes the transfer of a ribosyl phosphate group from 5-phosphoribose 1-diphosphate to orotate, leading to the formation of orotidine monophosphate (OMP).. | |
Protein Sequence | MSASTTSLEEYQKTFLELGLECKALRFGSFKLNSGRQSPYFFNLSLFNSGKLLANLATAYATAIIQSELKFDVIFGPAYKGIPLAAIVCVKLAEIGGTKFQGIQYAFNRKKVKDHGEGGIIVGASLEDKRVLIIDDVMTAGTAINEAFEIISIAQGRVVGCIVALDRQEVIHESDPERTSATQSVSKRYNVPVLSIVSLTQVVQFMGNRLSPEQKSAIENYRKAYGI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
179 | Phosphorylation | HESDPERTSATQSVS CCCCCCCCCCCHHHH | 22.50 | 22369663 | |
180 | Phosphorylation | ESDPERTSATQSVSK CCCCCCCCCCHHHHH | 35.22 | 22369663 | |
182 | Phosphorylation | DPERTSATQSVSKRY CCCCCCCCHHHHHHC | 22.57 | 22369663 | |
184 | Phosphorylation | ERTSATQSVSKRYNV CCCCCCHHHHHHCCC | 24.81 | 22369663 | |
186 | Phosphorylation | TSATQSVSKRYNVPV CCCCHHHHHHCCCCE | 19.36 | 22369663 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PYRX_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PYRX_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PYRX_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PYRE_YEAST | URA5 | genetic | 18408719 | |
PYRE_YEAST | URA5 | genetic | 16941010 | |
RL37A_YEAST | RPL37A | genetic | 20093466 | |
MNE1_YEAST | MNE1 | genetic | 20093466 | |
MGR2_YEAST | MGR2 | genetic | 20093466 | |
JID1_YEAST | JID1 | genetic | 20093466 | |
MRM2_YEAST | MRM2 | genetic | 27708008 | |
MED5_YEAST | NUT1 | genetic | 27708008 | |
PEX2_YEAST | PEX2 | genetic | 27708008 | |
PTK2_YEAST | PTK2 | genetic | 27708008 | |
CBT1_YEAST | CBT1 | genetic | 27708008 | |
SWS2_YEAST | SWS2 | genetic | 27708008 | |
MNE1_YEAST | MNE1 | genetic | 27708008 | |
QCR2_YEAST | QCR2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...