| UniProt ID | CUP2_YEAST | |
|---|---|---|
| UniProt AC | P15315 | |
| Protein Name | Transcriptional activator protein CUP2 | |
| Gene Name | CUP2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 225 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Trans-acting regulatory protein that activates transcription of the CUP1 gene (metallothionein) in response to copper ions. Binds to the CUP1 UAS sequence 5'-GCTTCTTTTCCGCTGA-3'. Binds DNA only in presence of copper or silver. Copper seems to alter the conformation of the protein.. | |
| Protein Sequence | MVVINGVKYACETCIRGHRAAQCTHTDGPLQMIRRKGRPSTTCGHCKELRRTKNFNPSGGCMCASARRPAVGSKEDETRCRCDEGEPCKCHTKRKSSRKSKGGSCHRRANDEAAHVNGLGIADLDVLLGLNGRSSDVDMTTTLPSLKPPLQNGEIKADSIDNLDLASLDPLEQSPSISMEPVSINETGSAYTTTNTALNDIDIPFSINELNELYKQVSSHNSHSQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 74 | Acetylation | RRPAVGSKEDETRCR CCCCCCCCCCCCCCC | 64.35 | 25381059 | |
| 134 | Phosphorylation | LLGLNGRSSDVDMTT HCCCCCCCCCCCCCC | 32.08 | 22369663 | |
| 135 | Phosphorylation | LGLNGRSSDVDMTTT CCCCCCCCCCCCCCC | 40.05 | 22369663 | |
| 140 | Phosphorylation | RSSDVDMTTTLPSLK CCCCCCCCCCCCCCC | 16.50 | 22369663 | |
| 141 | Phosphorylation | SSDVDMTTTLPSLKP CCCCCCCCCCCCCCC | 21.50 | 22369663 | |
| 142 | Phosphorylation | SDVDMTTTLPSLKPP CCCCCCCCCCCCCCC | 27.75 | 22369663 | |
| 145 | Phosphorylation | DMTTTLPSLKPPLQN CCCCCCCCCCCCCCC | 52.73 | 22369663 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CUP2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CUP2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CUP2_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
