| UniProt ID | CBF3C_YEAST | |
|---|---|---|
| UniProt AC | P35203 | |
| Protein Name | Centromere DNA-binding protein complex CBF3 subunit C | |
| Gene Name | CTF13 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 478 | |
| Subcellular Localization | Nucleus. Chromosome, centromere. | |
| Protein Description | Acts as central component of the centromere DNA-binding protein complex CBF3, which is essential for chromosome segregation and movement of centromeres along microtubules. CBF3 is required for the recruitment of other kinetochore complexes to CEN DNA. It plays a role in the attachment of chromosomes to the spindle and binds selectively to a highly conserved DNA sequence called CDEIII, found in centromers and in several promoters. The association of CBF3C with CBF3D and SGT1 is required for CBF3C activation and CBF3 assembly.. | |
| Protein Sequence | MPSFNPVRFLELPIDIRKEVYFHLDGNFCGAHPYPIDILYKSNDVELPGKPSYKRSKRSKKLLRYMYPVFATYLNIFEYSPQLIEKWLEYAFWLRYDCLVLDCFKVNHLYDGTLIDALEWTYLDNELRLAYFNKASMLEVWYTFKEYKKWVIDSVAFDELDLLNVSNIQFNIDNLTPQLVDKCLSILEQKDLFATIGEVQFGQDEEVGEEKDVDVSGANSDENSSPSSTIKNKKRSASKRSHSDNGNVGATHNQLTSISVIRTIRSMESMKSLRKITVRGEKLYELLINFHGFRDNPGKTISYIVKRRINEIRLSRMNQISRTGLADFTRWDNLQKLVLSRVAYIDLNSIVFPKNFKSLTMKRVSKIKWWNIEENILKELKVDKRTFKSLYIKEDDSKFTKFFNLRHTRIKELDKSEINQITYLRCQAIVWLSFRTLNHIKLQNVSEVFNNIIVPRALFDSKRVEIYRCEKISQVLVI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 3 | Phosphorylation | -----MPSFNPVRFL -----CCCCCCCEEE | 36.04 | 28889911 | |
| 56 | Phosphorylation | GKPSYKRSKRSKKLL CCCCCCCCHHHHHHH | 28.41 | 21440633 | |
| 216 | Phosphorylation | EEKDVDVSGANSDEN CCCCCCCCCCCCCCC | 27.94 | 20377248 | |
| 220 | Phosphorylation | VDVSGANSDENSSPS CCCCCCCCCCCCCCC | 45.85 | 22369663 | |
| 224 | Phosphorylation | GANSDENSSPSSTIK CCCCCCCCCCCHHHH | 41.39 | 22369663 | |
| 225 | Phosphorylation | ANSDENSSPSSTIKN CCCCCCCCCCHHHHC | 40.14 | 22369663 | |
| 227 | Phosphorylation | SDENSSPSSTIKNKK CCCCCCCCHHHHCCC | 41.90 | 22369663 | |
| 228 | Phosphorylation | DENSSPSSTIKNKKR CCCCCCCHHHHCCCC | 37.22 | 22369663 | |
| 229 | Phosphorylation | ENSSPSSTIKNKKRS CCCCCCHHHHCCCCC | 40.07 | 22369663 | |
| 243 | Phosphorylation | SASKRSHSDNGNVGA CCCCCCCCCCCCCCC | 33.74 | 27017623 | |
| 256 | Phosphorylation | GATHNQLTSISVIRT CCCHHHHHHHHHHHH | 17.79 | 27017623 | |
| 263 | Phosphorylation | TSISVIRTIRSMESM HHHHHHHHHHCHHHH | 15.04 | 27017623 |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CBF3C_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CBF3C_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
