AQY2_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AQY2_YEAST
• UniProt AC: P0CD90
• Protein Name: Aquaporin-like protein 2
• Gene Name: AQY2
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 149
• Subcellular Localization: Endoplasmic reticulum membrane ; Multi-pass membrane protein . Cell membrane; Multi-pass membrane protein .
• Protein Description: Water channel required to facilitate the transport of water across membranes. Involved in freeze tolerance, osmotolerance and cell flocculation in liquid cultures (By similarity). Is non-functional in most laboratory strains..
• Protein Sequence: MSNESNDLEKNISHLDPTGVDNAYIPPEQPETKHSRFNIDRDTLRNHFIAAVGEFCGTFMFLWCAYVICNVANHDVALTTEPEGSHPGQLIMIALGFGFSVMFSIWCFWWGFEPSRFSLFVFGQSHLTSQMCSDVVSSDHCWDGCWWCR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of AQY2_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AQY2_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AQY2_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AQY2_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EMC6_YEAST	EMC6	genetic	16269340
POM33_YEAST	POM33	genetic	16269340
GYP1_YEAST	GYP1	genetic	16269340
PFD2_YEAST	GIM4	genetic	16269340
BFR1_YEAST	BFR1	genetic	16269340
YME1_YEAST	YME1	genetic	20093466
PFD2_YEAST	GIM4	genetic	20526336

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.