| UniProt ID | STE14_YEAST | |
|---|---|---|
| UniProt AC | P32584 | |
| Protein Name | Protein-S-isoprenylcysteine O-methyltransferase | |
| Gene Name | STE14 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 239 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein . |
|
| Protein Description | Mediates C-terminal methylation of the isoprenylated C-terminal cysteine in A-factor mating pheromone and Ras proteins.. | |
| Protein Sequence | MHQDFQEDEHEYPDIRRNPLHEVTMTSYILGILLGIFVGLFPQIRFKNFNLFIIALSLFHFLEYYITAKYNPLKVHSESFLLNNGKSYMAAHSFAILECLVESFLFPDLKIFSYSLATKLCTVLGCLLVILGQYTRTIAMHTAGHSFSHIVKTKKESDHVLVKTGVYSWSRHPSYLGFFWWAIGTQLLLLNPLSLVIFIFVLWKFFSDRIRVEEKYLIEFFSAEYIEYKNKVGVGIPFI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 79 | Phosphorylation | PLKVHSESFLLNNGK CCEECCEEEECCCCC | 24.98 | 30377154 | |
| 168 | Phosphorylation | LVKTGVYSWSRHPSY EEEECCCCCCCCHHH | 19.03 | 19779198 | |
| 170 | Phosphorylation | KTGVYSWSRHPSYLG EECCCCCCCCHHHHH | 18.12 | 30377154 | |
| 216 | Phosphorylation | RIRVEEKYLIEFFSA CCCCCHHHHHHHHHH | 19.05 | 30377154 | |
| 222 | Phosphorylation | KYLIEFFSAEYIEYK HHHHHHHHHHHHHHH | 26.05 | 30377154 | |
| 225 | Phosphorylation | IEFFSAEYIEYKNKV HHHHHHHHHHHHCCC | 9.96 | 30377154 | |
| 228 | Phosphorylation | FSAEYIEYKNKVGVG HHHHHHHHHCCCCCC | 15.42 | 30377154 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of STE14_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of STE14_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of STE14_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RAS2_YEAST | RAS2 | physical | 15611058 | |
| ERFD_YEAST | SHR5 | genetic | 16269340 | |
| ERFB_YEAST | ERF2 | genetic | 16269340 | |
| RGP1_YEAST | RGP1 | genetic | 16269340 | |
| RIC1_YEAST | RIC1 | genetic | 16269340 | |
| STE14_YEAST | STE14 | physical | 20202940 | |
| UBC6_YEAST | UBC6 | physical | 25691244 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
