dbPTM

YP027_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YP027_YEAST
UniProt AC	Q12079
Protein Name	Uncharacterized membrane protein YPR027C
Gene Name	YPR027C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	277
Subcellular Localization	Membrane Multi-pass membrane protein.
Protein Description
Protein Sequence	MVGIYRILASFVPLLGLLFAFHDDDMIDTVTIIKTVYETVTSTSTAPAPAATKSVSEKKLDDTKLTLQVIQTMVSCFSVGENPANMISCGLGVVILMFSLIIELINKLENDGINEPQRLYDLIKPKYVELPSNYVNEKIKTTFEPLDLYLGVNMNTSGSELNQNCLILKLGEKTALPFPGLAQQICYTKGASNEFTNYKLSDIQGNLNENSQGIANGVFQKISNIRKISGNFKSQLYQISEKITDENWDGSAVGFTAHGREKGPNKSQISVSFYRDN

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
155	N-linked_Glycosylation	LYLGVNMNTSGSELN EEEEECCCCCCHHHC	26.37	-
265	N-linked_Glycosylation	HGREKGPNKSQISVS CCCCCCCCCCCEEEE	66.34	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YP027_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YP027_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YP027_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
STU1_YEAST	STU1	genetic	27708008
AAR2_YEAST	AAR2	genetic	27708008
PRP6_YEAST	PRP6	genetic	27708008
MCM7_YEAST	MCM7	genetic	27708008
FAD1_YEAST	FAD1	genetic	27708008
CDC48_YEAST	CDC48	genetic	27708008
CDC37_YEAST	CDC37	genetic	27708008
SCC4_YEAST	SCC4	genetic	27708008
GNA1_YEAST	GNA1	genetic	27708008
MOB2_YEAST	MOB2	genetic	27708008
YPT1_YEAST	YPT1	genetic	27708008
TAF1_YEAST	TAF1	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
LCB1_YEAST	LCB1	genetic	27708008
DCP2_YEAST	DCP2	genetic	27708008
NAT10_YEAST	KRE33	genetic	27708008
RPA1_YEAST	RPA190	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YP027_YEAST

Related Literatures of Post-Translational Modification