UniProt ID | PRM5_YEAST | |
---|---|---|
UniProt AC | P40476 | |
Protein Name | Pheromone-regulated membrane protein 5 | |
Gene Name | PRM5 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 318 | |
Subcellular Localization |
Membrane Single-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MTVITIAKRGLPKLTTSTSSTTTASSSSTITSVASSSSSLPLLSNSTSSSIIPSITPPSRNGNPYILDSGDMPNGTVFIVVGGIAGVIFLAILLWWVITTYSSHRLTRSVQDYESKMFSTQHTQFYGDSPYMDYPAKENFQDQVHISESDISPGNKDESVKDALVSHTNNEKPFLSNFERPLFSLASESNRNSLFISPTGDILYKTRLSKLYQESPRLLQKPVIMTSDNVSTNSLVSTISSSSASSLDNGNEKEVGEDIRKPAKIASSPSRKLLNSPESDGSVNRNHSKGNLLVVQSKRKPTPSTYLEHMLEGKEQDE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTVITIAKR ------CCEEEEECC | 22.18 | 19823750 | |
5 | Phosphorylation | ---MTVITIAKRGLP ---CCEEEEECCCCC | 15.56 | 19823750 | |
116 | Ubiquitination | SVQDYESKMFSTQHT CHHHHHHHHHCCCCC | 31.83 | 23749301 | |
129 | Phosphorylation | HTQFYGDSPYMDYPA CCCCCCCCCCCCCCC | 17.36 | 17330950 | |
147 | Phosphorylation | FQDQVHISESDISPG CCCCEEECHHHCCCC | 19.03 | 21440633 | |
149 | Phosphorylation | DQVHISESDISPGNK CCEEECHHHCCCCCC | 33.19 | 24961812 | |
152 | Phosphorylation | HISESDISPGNKDES EECHHHCCCCCCCHH | 31.57 | 24961812 | |
159 | Phosphorylation | SPGNKDESVKDALVS CCCCCCHHHHHHHHH | 44.60 | 28889911 | |
187 | Phosphorylation | RPLFSLASESNRNSL CCHHHHHCCCCCCCE | 47.02 | 30377154 | |
189 | Phosphorylation | LFSLASESNRNSLFI HHHHHCCCCCCCEEE | 38.30 | 30377154 | |
197 | Phosphorylation | NRNSLFISPTGDILY CCCCEEECCCCHHHH | 14.74 | 28132839 | |
199 | Phosphorylation | NSLFISPTGDILYKT CCEEECCCCHHHHHH | 40.47 | 28132839 | |
205 | Ubiquitination | PTGDILYKTRLSKLY CCCHHHHHHHHHHHH | 24.59 | 23749301 | |
210 | Ubiquitination | LYKTRLSKLYQESPR HHHHHHHHHHHHCCH | 56.67 | 23749301 | |
215 | Phosphorylation | LSKLYQESPRLLQKP HHHHHHHCCHHHCCC | 10.37 | 25005228 | |
267 | Phosphorylation | RKPAKIASSPSRKLL HHHHHHCCCCCHHHC | 46.37 | 27717283 | |
268 | Phosphorylation | KPAKIASSPSRKLLN HHHHHCCCCCHHHCC | 20.20 | 28889911 | |
270 | Phosphorylation | AKIASSPSRKLLNSP HHHCCCCCHHHCCCC | 43.95 | 23749301 | |
272 | Ubiquitination | IASSPSRKLLNSPES HCCCCCHHHCCCCCC | 62.76 | 23749301 | |
276 | Phosphorylation | PSRKLLNSPESDGSV CCHHHCCCCCCCCCC | 29.98 | 19823750 | |
279 | Phosphorylation | KLLNSPESDGSVNRN HHCCCCCCCCCCCCC | 51.13 | 17330950 | |
282 | Phosphorylation | NSPESDGSVNRNHSK CCCCCCCCCCCCCCC | 22.62 | 17330950 | |
288 | Phosphorylation | GSVNRNHSKGNLLVV CCCCCCCCCCCEEEE | 45.89 | 17330950 | |
302 | Phosphorylation | VQSKRKPTPSTYLEH EECCCCCCCCHHHHH | 32.67 | 23749301 | |
304 | Phosphorylation | SKRKPTPSTYLEHML CCCCCCCCHHHHHHH | 31.96 | 24961812 | |
305 | Phosphorylation | KRKPTPSTYLEHMLE CCCCCCCHHHHHHHC | 33.07 | 24961812 | |
314 | Ubiquitination | LEHMLEGKEQDE--- HHHHHCCCCCCC--- | 42.71 | 23749301 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRM5_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRM5_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRM5_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDC24_YEAST | CDC24 | genetic | 27708008 | |
RPB1_YEAST | RPO21 | genetic | 27708008 | |
FCF1_YEAST | FCF1 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
SWC4_YEAST | SWC4 | genetic | 27708008 | |
ZPR1_YEAST | ZPR1 | genetic | 27708008 | |
NDC80_YEAST | NDC80 | genetic | 27708008 | |
SLN1_YEAST | SLN1 | genetic | 27708008 | |
NU192_YEAST | NUP192 | genetic | 27708008 | |
PRI2_YEAST | PRI2 | genetic | 27708008 | |
PRS7_YEAST | RPT1 | genetic | 27708008 | |
ORC1_YEAST | ORC1 | genetic | 27708008 | |
MED11_YEAST | MED11 | genetic | 27708008 | |
SPC24_YEAST | SPC24 | genetic | 27708008 | |
SEC12_YEAST | SEC12 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-279 AND SER-282, ANDMASS SPECTROMETRY. | |
"Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-279, AND MASSSPECTROMETRY. | |
"Large-scale phosphorylation analysis of alpha-factor-arrestedSaccharomyces cerevisiae."; Li X., Gerber S.A., Rudner A.D., Beausoleil S.A., Haas W., Villen J.,Elias J.E., Gygi S.P.; J. Proteome Res. 6:1190-1197(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-129; SER-279; SER-282AND SER-288, AND MASS SPECTROMETRY. |