| UniProt ID | PTE1_YEAST | |
|---|---|---|
| UniProt AC | P41903 | |
| Protein Name | Peroxisomal acyl-coenzyme A thioester hydrolase 1 | |
| Gene Name | TES1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 349 | |
| Subcellular Localization | Peroxisome . | |
| Protein Description | Acyl-coenzyme A (acyl-CoA) thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Contributes to growth on fatty acids.. | |
| Protein Sequence | MSASKMAMSNLEKILELVPLSPTSFVTKYLPAAPVGSKGTFGGTLVSQSLLASLHTVPLNFFPTSLHSYFIKGGDPRTKITYHVQNLRNGRNFIHKQVSAYQHDKLIFTSMILFAVQRSKEHDSLQHWETIPGLQGKQPDPHRYEEATSLFQKEVLDPQKLSRYASLSDRFQDATSMSKYVDAFQYGVMEYQFPKDMFYSARHTDELDYFVKVRPPITTVEHAGDESSLHKHHPYRIPKSITPENDARYNYVAFAYLSDSYLLLTIPYFHNLPLYCHSFSVSLDHTIYFHQLPHVNNWIYLKISNPRSHWDKHLVQGKYFDTQSGRIMASVSQEGYVVYGSERDIRAKF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | Acetylation | SPTSFVTKYLPAAPV CCCHHHCCCCCCCCC | 39.22 | 24489116 | |
| 79 | Ubiquitination | KGGDPRTKITYHVQN CCCCCCCEEEEEEEE | 34.04 | 22817900 | |
| 239 | Ubiquitination | HHPYRIPKSITPEND CCCCCCCCCCCCCCC | 52.71 | 23749301 | |
| 332 | Phosphorylation | GRIMASVSQEGYVVY CEEEEEECCCCEEEE | 21.73 | 27017623 | |
| 339 | Phosphorylation | SQEGYVVYGSERDIR CCCCEEEECCCCCCC | 12.61 | 27017623 | |
| 341 | Phosphorylation | EGYVVYGSERDIRAK CCEEEECCCCCCCCC | 16.27 | 27017623 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTE1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTE1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTE1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MCFS2_YEAST | EHT1 | genetic | 20093466 | |
| INO2_YEAST | INO2 | genetic | 20093466 | |
| SNF6_YEAST | SNF6 | genetic | 20093466 | |
| CSF1_YEAST | CSF1 | genetic | 20093466 | |
| RAS2_YEAST | RAS2 | genetic | 20093466 | |
| MDM12_YEAST | MDM12 | genetic | 20093466 | |
| ADH3_YEAST | ADH3 | genetic | 21623372 | |
| COQ3_YEAST | COQ3 | genetic | 21623372 | |
| QCR2_YEAST | QCR2 | genetic | 21623372 | |
| KCS1_YEAST | KCS1 | genetic | 21623372 | |
| I23O_YEAST | BNA2 | genetic | 24997118 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
