RL22B_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RL22B_YEAST
• UniProt AC: P56628
• Protein Name: 60S ribosomal protein L22-B {ECO:0000303|PubMed:9559554}
• Gene Name: RPL22B {ECO:0000303|PubMed:9559554}
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 122
• Subcellular Localization: Cytoplasm .
• Protein Description: Component of the ribosome, a large ribonucleoprotein complex responsible for the synthesis of proteins in the cell. The small ribosomal subunit (SSU) binds messenger RNAs (mRNAs) and translates the encoded message by selecting cognate aminoacyl-transfer RNA (tRNA) molecules. The large subunit (LSU) contains the ribosomal catalytic site termed the peptidyl transferase center (PTC), which catalyzes the formation of peptide bonds, thereby polymerizing the amino acids delivered by tRNAs into a polypeptide chain. The nascent polypeptides leave the ribosome through a tunnel in the LSU and interact with protein factors that function in enzymatic processing, targeting, and the membrane insertion of nascent chains at the exit of the ribosomal tunnel..
• Protein Sequence: MAPNTSRKQKVIKTLTVDVSSPTENGVFDPASYSKYLIDHIKVDGAVGNLGNAIEVTEDGSIVTVVSSAKFSGKYLKYLTKKYLKKNQLRDWIRFVSIRQNQYKLVFYQVTPEDADEEEDDE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Phosphorylation	TVDVSSPTENGVFDP EECCCCCCCCCCCCH	43.99	28889911
75	Phosphorylation	SAKFSGKYLKYLTKK CCCCCHHHHHHHHHH	16.38	19823750
78	Phosphorylation	FSGKYLKYLTKKYLK CCHHHHHHHHHHHHH	19.60	19823750
80	Phosphorylation	GKYLKYLTKKYLKKN HHHHHHHHHHHHHHC	23.54	19823750
111	Phosphorylation	KLVFYQVTPEDADEE EEEEEEECCCCCCCC	12.87	28152593

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of RL22B_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RL22B_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RL22B_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of RL22B_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.