YMC1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YMC1_YEAST
• UniProt AC: P32331
• Protein Name: Mitochondrial glycine transporter YMC1
• Gene Name: YMC1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 307
• Subcellular Localization: Mitochondrion inner membrane ; Multi-pass membrane protein .
• Protein Description: Secondary mitochondrial glycine transporter required for the biosynthesis of heme at high glycine concentrations. Imports the precursor glycine into the mitochondrial matrix, where it is condensed with succinyl-CoA to produce 5-aminolevulinate (ALA), the first step of heme biosynthesis..
• Protein Sequence: MSEEFPSPQLIDDLEEHPQHDNARVVKDLLAGTAGGIAQVLVGQPFDTTKVRLQTSSTPTTAMEVVRKLLANEGPRGFYKGTLTPLIGVGACVSLQFGVNEAMKRFFHHRNADMSSTLSLPQYYACGVTGGIVNSFLASPIEHVRIRLQTQTGSGTNAEFKGPLECIKKLRHNKALLRGLTPTILREGHGCGTYFLVYEALIANQMNKRRGLERKDIPAWKLCIFGALSGTALWLMVYPLDVIKSVMQTDNLQKPKFGNSISSVAKTLYANGGIGAFFKGFGPTMLRAAPANGATFATFELAMRLLG

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
256	Acetylation	TDNLQKPKFGNSISS CCCCCCCCCCCCHHH	73.30	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YMC1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YMC1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YMC1_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YMC1_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.