AAD6_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: AAD6_YEAST
• UniProt AC: P43547
• Protein Name: Putative aryl-alcohol dehydrogenase AAD6 {ECO:0000303|PubMed:10581269}
• Gene Name: AAD6 {ECO:0000303|PubMed:10581269}
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 212
• Protein Sequence: MADLFAPAPEPSTELGRLRVLSKSAGIRVSPLILGGMSIGDAWSEILGSMSKERAFELLDAFYEAGGNFIDTANNYQNEQSEAWIGEWMVSRKLRDQIVIATKFTTDYKKYDVGGGKSANYCGNHKRSLHVSVRDSLRKLQTDWIDILYVHWWDYMSSIEEVMDSLHILVQQARSSIWVCLIRLPGLFLRQITTLNLMVKPLLASIKVNGTC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
23	Acetylation	GRLRVLSKSAGIRVS HHHHHHHCCCCCCCC	39.92	25381059
111	Phosphorylation	FTTDYKKYDVGGGKS ECCCCCCEECCCCCC	16.23	22817900
118	Phosphorylation	YDVGGGKSANYCGNH EECCCCCCCCCCCCC	25.64	21177495

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of AAD6_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of AAD6_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of AAD6_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DHAS_YEAST	HOM2	genetic	23111598
SMT3_YEAST	SMT3	genetic	27708008
SMC1_YEAST	SMC1	genetic	27708008
CDC12_YEAST	CDC12	genetic	27708008
CDC11_YEAST	CDC11	genetic	27708008
MED14_YEAST	RGR1	genetic	27708008
TYSY_YEAST	CDC21	genetic	27708008
PROF_YEAST	PFY1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.