dbPTM

SAS5_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	SAS5_YEAST
UniProt AC	Q99314
Protein Name	Something about silencing protein 5
Gene Name	SAS5
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	248
Subcellular Localization	Nucleus .
Protein Description	Component of the SAS complex, a multiprotein complex that acetylates 'Lys-16' of histone H4 and 'Lys-14' of histone H3. The SAS complex is however unable to acetylate nucleosomal histones. The complex is involved in transcriptional silencing at telomeres and at HML locus. Also involved in rDNA silencing. In the complex, SAS5 is required for maximal histone acetyltransferase (HAT) activity of the complex, suggesting that it may be required to stabilize the complex or help in substrate recognition..
Protein Sequence	MDHSIEVTFRVKTQQVIIPEQNIRGNELPLRRWQMELLMLDATGKEVEPTILSKCIYHLHSSFKQPKRRLNSLPFFIKETGWGEFNLKIECFFIGNAGKFSIEHDLTFEDDAYAVDYTVDVPHEFSHLNSELSKYFDLPWKVVSPEEEMSLRIADLPWIKSLALIDEDMMTDVVQMILNDPAVQRAIENHPRREQFFMFITQLPDDLLMKIQAFLKLPNKNSTKQERTNFGSDAIHKDEPVKAHNKLK

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
62	Phosphorylation	CIYHLHSSFKQPKRR HHHHHHHCCCCCCHH	26.22	27017623
72	Phosphorylation	QPKRRLNSLPFFIKE CCCHHHHCCCEEEEE	41.85	27017623
144	Phosphorylation	DLPWKVVSPEEEMSL CCCCCCCCHHHHHHH	29.58	28152593
237	Acetylation	FGSDAIHKDEPVKAH CCCCCCCCCCCCCCC	58.64	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of SAS5_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of SAS5_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of SAS5_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SAS2_YEAST	SAS2	physical	11731480
SAS4_YEAST	SAS4	physical	12626510
ASF1_YEAST	ASF1	physical	11731480
RLF2_YEAST	RLF2	physical	11731480
SAS4_YEAST	SAS4	physical	11731480
SIR4_YEAST	SIR4	genetic	10471696
YRA1_YEAST	YRA1	physical	16554755
RRS1_YEAST	RRS1	physical	16554755
SAS4_YEAST	SAS4	physical	15788653
SAS2_YEAST	SAS2	physical	15788653
IMB4_YEAST	KAP123	physical	15788653
IMB3_YEAST	PSE1	physical	15788653
RPD3_YEAST	RPD3	genetic	17314980
SIN3_YEAST	SIN3	genetic	17314980
SIR1_YEAST	SIR1	genetic	17314980
BUB3_YEAST	BUB3	genetic	17314980
DEP1_YEAST	DEP1	genetic	17314980
PRI1_YEAST	PRI1	genetic	17314980
SAP30_YEAST	SAP30	genetic	17314980
SDS3_YEAST	SDS3	genetic	17314980
LSM1_YEAST	LSM1	genetic	17314980
RAP1_YEAST	RAP1	genetic	17314980
EAF1_YEAST	EAF1	genetic	17314980
PHO23_YEAST	PHO23	genetic	17314980
PFD6_YEAST	YKE2	genetic	17314980
ARP4_YEAST	ARP4	genetic	17314980
ASF1_YEAST	ASF1	genetic	17314980
IES4_YEAST	IES4	genetic	17314980
PFD5_YEAST	GIM5	genetic	17314980
GCN1_YEAST	GCN1	genetic	17314980
CSF1_YEAST	CSF1	genetic	17314980
SWD2_YEAST	SWD2	genetic	17314980
SSB1_YEAST	SSB1	physical	19536198
RPD3_YEAST	RPD3	genetic	20133733
YFF4_YEAST	YFL054C	genetic	27708008
DBF4_YEAST	DBF4	genetic	27708008
TCPA_YEAST	TCP1	genetic	27708008
HRP1_YEAST	HRP1	genetic	27708008
SWD1_YEAST	SWD1	genetic	27708008
ECM21_YEAST	ECM21	genetic	27708008
AIM4_YEAST	AIM4	genetic	27708008
CHK1_YEAST	CHK1	genetic	27708008
RV161_YEAST	RVS161	genetic	27708008
RIM1_YEAST	RIM1	genetic	27708008
NHP10_YEAST	NHP10	genetic	27708008
BRE1_YEAST	BRE1	genetic	27708008
RGI1_YEAST	RGI1	genetic	27708008
UBP3_YEAST	UBP3	genetic	27708008
RAD4_YEAST	RAD4	genetic	27708008
BUD27_YEAST	BUD27	genetic	27708008
SAP30_YEAST	SAP30	genetic	27708008
AEP2_YEAST	AEP2	genetic	27708008
RL21B_YEAST	RPL21B	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of SAS5_YEAST

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-144, AND MASSSPECTROMETRY.	18407956 [Abstract]