UniProt ID | YHP1_YEAST | |
---|---|---|
UniProt AC | Q04116 | |
Protein Name | Homeobox protein YHP1 | |
Gene Name | YHP1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 353 | |
Subcellular Localization | Nucleus. | |
Protein Description | Transcriptional repressor required to restrict transcription of ECB-dependent genes to the G1/M phase by repressing their transcription during S late phase. Genes that contain a ECB (early cell box) element in their transcription regulatory region are transcribed only during G1/M phases. Binds the IMEI regulatory region in vitro, its relevance in vivo is however unclear.. | |
Protein Sequence | MESRNTVLPSLPNIITGTSNSPFQLHTLPNTNFPSDDQGDIRLPPLAASAHIVRPVVNIYKSPCDEERPKRKSPQAVDFLSQRVTTSMTPLSKPKKLSSHSPFTPTVRVCSKEQPPQSMHSYKKVNILTPLSAAKAVLTPTTRKEKKRSFAFITHSQETFPKKEPKIDNARLARRKRRRTSSYELGILQTAFDECPTPNKAKRIELSEQCNMSEKSVQIWFQNKRQAAKKHKNSGNTSHCKVHSNDSMSMISYSDAALEITSTPTSTKEAITAELLKTSPANTSSIFEDHHITPCKPGGQLKFHRKSVLVKRTLSNTGHSEIIKSPKGKENRLKFNAYERKPLGEVDLNSFKN | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
62 | Phosphorylation | PVVNIYKSPCDEERP CCCHHHCCCCCCCCC | 17.49 | 28889911 | |
73 | Phosphorylation | EERPKRKSPQAVDFL CCCCCCCCHHHHHHH | 26.69 | 28889911 | |
86 | Phosphorylation | FLSQRVTTSMTPLSK HHHHHCCCCCCCCCC | 17.40 | 28152593 | |
101 | Phosphorylation | PKKLSSHSPFTPTVR CCCCCCCCCCCCEEE | 24.53 | 28889911 | |
111 | Phosphorylation | TPTVRVCSKEQPPQS CCEEEECCCCCCCCC | 36.05 | 28889911 | |
121 | Phosphorylation | QPPQSMHSYKKVNIL CCCCCCCCCCEEEEE | 29.97 | 28889911 | |
122 | Phosphorylation | PPQSMHSYKKVNILT CCCCCCCCCEEEEEC | 10.51 | 28889911 | |
129 | Phosphorylation | YKKVNILTPLSAAKA CCEEEEECHHHHHHH | 20.56 | 28889911 | |
132 | Phosphorylation | VNILTPLSAAKAVLT EEEECHHHHHHHHCC | 27.64 | 24961812 | |
139 | Phosphorylation | SAAKAVLTPTTRKEK HHHHHHCCCCCCCCH | 16.40 | 21440633 | |
141 | Phosphorylation | AKAVLTPTTRKEKKR HHHHCCCCCCCCHHC | 33.72 | 21551504 | |
142 | Phosphorylation | KAVLTPTTRKEKKRS HHHCCCCCCCCHHCC | 40.73 | 26447709 | |
253 | Phosphorylation | DSMSMISYSDAALEI CCEEEEEECCCEEEE | 10.31 | 19779198 | |
265 | Phosphorylation | LEITSTPTSTKEAIT EEEECCCCCHHHHHH | 49.47 | 19779198 | |
272 | Phosphorylation | TSTKEAITAELLKTS CCHHHHHHHHHHHCC | 22.56 | 21440633 | |
278 | Phosphorylation | ITAELLKTSPANTSS HHHHHHHCCCCCCCH | 39.65 | 21551504 | |
279 | Phosphorylation | TAELLKTSPANTSSI HHHHHHCCCCCCCHH | 22.04 | 21440633 | |
284 | Phosphorylation | KTSPANTSSIFEDHH HCCCCCCCHHHCCCC | 22.65 | 21440633 | |
293 | Phosphorylation | IFEDHHITPCKPGGQ HHCCCCCCCCCCCCE | 20.48 | 21440633 | |
313 | Phosphorylation | KSVLVKRTLSNTGHS CEEEEEEECCCCCCC | 28.90 | 19823750 | |
315 | Phosphorylation | VLVKRTLSNTGHSEI EEEEEECCCCCCCCC | 31.56 | 20377248 | |
317 | Phosphorylation | VKRTLSNTGHSEIIK EEEECCCCCCCCCCC | 32.66 | 21440633 | |
320 | Phosphorylation | TLSNTGHSEIIKSPK ECCCCCCCCCCCCCC | 31.66 | 19823750 | |
325 | Phosphorylation | GHSEIIKSPKGKENR CCCCCCCCCCCCCCC | 22.80 | 21440633 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YHP1_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YHP1_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YHP1_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDC10_YEAST | CDC10 | genetic | 17314980 | |
REI1_YEAST | REI1 | genetic | 17314980 | |
POLH_YEAST | RAD30 | genetic | 17314980 | |
IWR1_YEAST | IWR1 | genetic | 17314980 | |
NOT2_YEAST | CDC36 | genetic | 17314980 | |
PLPHP_YEAST | YBL036C | genetic | 17314980 | |
RTG2_YEAST | RTG2 | genetic | 27708008 | |
RL22A_YEAST | RPL22A | genetic | 27708008 | |
SS120_YEAST | SSP120 | genetic | 27708008 | |
YCY0_YEAST | YCR090C | genetic | 27708008 | |
AIM11_YEAST | AIM11 | genetic | 27708008 | |
SHC1_YEAST | SHC1 | genetic | 27708008 | |
YFF1_YEAST | YFL051C | genetic | 27708008 | |
KSS1_YEAST | KSS1 | genetic | 27708008 | |
CHO2_YEAST | CHO2 | genetic | 27708008 | |
YL287_YEAST | YLR287C | genetic | 27708008 | |
EOS1_YEAST | EOS1 | genetic | 27708008 | |
RAS2_YEAST | RAS2 | genetic | 27708008 | |
NAA30_YEAST | MAK3 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-315, AND MASSSPECTROMETRY. |