| UniProt ID | VATO_YEAST | |
|---|---|---|
| UniProt AC | P23968 | |
| Protein Name | V-type proton ATPase subunit c'' | |
| Gene Name | VMA16 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 213 | |
| Subcellular Localization |
Membrane Multi-pass membrane protein. |
|
| Protein Description | Proton-conducting pore forming subunit of the membrane integral V0 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.. | |
| Protein Sequence | MNKESKDDDMSLGKFSFSHFLYYLVLIVVIVYGLYKLFTGHGSDINFGKFLLRTSPYMWANLGIALCVGLSVVGAAWGIFITGSSMIGAGVRAPRITTKNLISIIFCEVVAIYGLIIAIVFSSKLTVATAENMYSKSNLYTGYSLFWAGITVGASNLICGIAVGITGATAAISDAADSALFVKILVIEIFGSILGLLGLIVGLLMAGKASEFQ | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of VATO_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VATO_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VATO_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VATO_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| GST1_YEAST | GTT1 | physical | 18719252 | |
| ERP2_YEAST | ERP2 | physical | 16093310 | |
| LDS1_YEAST | LDS1 | physical | 16093310 | |
| YAJ8_YEAST | YAR028W | physical | 16093310 | |
| PHO88_YEAST | PHO88 | physical | 16093310 | |
| ALG1_YEAST | ALG1 | physical | 16093310 | |
| MKAR_YEAST | IFA38 | physical | 16093310 | |
| PBN1_YEAST | PBN1 | physical | 16093310 | |
| TECR_YEAST | TSC13 | physical | 16093310 | |
| SHR3_YEAST | SHR3 | physical | 16093310 | |
| OST4_YEAST | OST4 | physical | 16093310 | |
| ERV29_YEAST | ERV29 | physical | 16093310 | |
| AVT7_YEAST | AVT7 | physical | 16093310 | |
| YET1_YEAST | YET1 | physical | 16093310 | |
| MCH2_YEAST | MCH2 | physical | 16093310 | |
| ELO3_YEAST | ELO3 | physical | 16093310 | |
| ERP4_YEAST | ERP4 | physical | 16093310 | |
| ECM3_YEAST | ECM3 | physical | 16093310 | |
| TPO3_YEAST | TPO3 | physical | 16093310 | |
| VATO_YEAST | VMA16 | physical | 16093310 | |
| SRS2_YEAST | SRS2 | genetic | 21459050 | |
| KASH5_HUMAN | CCDC155 | physical | 27107014 | |
| CR3L1_HUMAN | CREB3L1 | physical | 27107014 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
