| UniProt ID | PBN1_YEAST | |
|---|---|---|
| UniProt AC | P25580 | |
| Protein Name | Protein PBN1 | |
| Gene Name | PBN1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 416 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type III membrane protein . |
|
| Protein Description | Required for proper folding and/or the stability of a subset of proteins in the endoplasmic reticulum. Aids the autocatalytic processing of PRB1. Component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase GPI14.. | |
| Protein Sequence | MVTRHRVTVLYNAPEDIGNHMRQNDTHLTVRGGSGVVLQQRWLLERTGSLDKSFTRITWRPRADLARSLSVIENELSAGFSVYSNSSDVPERFITNPVYNSFHSEKFDIEQYLPPEVDLNLSWNPEDFTYDISVEPTQIQIVEYRLLKQGEEFTIARVKDEKLEVGVFFVDASDESDVDIGGIRCNWRMDDGKMERCQKTSLLYKQGHIAYNHSTTTTSLYLNEPIGLHPKIMIDLTDFEERPKCMYLMHLQLPLELFIDKFQSSPLLLFGEDDLELPEYSLRDKAWGSESIFELKAGTMNEVTLHTRYIEPSNNKGDKLEVSFDPEVILACDTGDNKVSRNPFYKKGLGYESLFTDDTTFRHLNSTTLLVPIPRPDTKDYSKIKNGTLLCLLISIIYIFSKVFGNNKKKRSVKRE | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 8 | Phosphorylation | MVTRHRVTVLYNAPE CCCEEEEEEEECCCH | 12.54 | 28889911 | |
| 11 | Phosphorylation | RHRVTVLYNAPEDIG EEEEEEEECCCHHHH | 12.63 | 28889911 | |
| 24 | N-linked_Glycosylation | IGNHMRQNDTHLTVR HHHHHHCCCCEEEEE | 45.87 | - | |
| 85 | N-linked_Glycosylation | AGFSVYSNSSDVPER CCEEEECCCCCCCHH | 28.04 | - | |
| 120 | N-linked_Glycosylation | LPPEVDLNLSWNPED CCCCCEECCCCCHHH | 27.80 | - | |
| 176 | Phosphorylation | FVDASDESDVDIGGI EEECCCCCCCEECCE | 48.18 | 27214570 | |
| 212 | N-linked_Glycosylation | KQGHIAYNHSTTTTS ECCCEEECCCCCCEE | 17.38 | - | |
| 285 | Ubiquitination | PEYSLRDKAWGSESI CCCCCCCCCCCCCCE | 39.34 | 19722269 | |
| 304 | Phosphorylation | AGTMNEVTLHTRYIE CCCCCEEEEEEEEEE | 13.47 | 27017623 | |
| 307 | Phosphorylation | MNEVTLHTRYIEPSN CCEEEEEEEEEECCC | 28.42 | 27017623 | |
| 365 | N-linked_Glycosylation | DTTFRHLNSTTLLVP CCCEECCCCCEEEEE | 31.05 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PBN1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PBN1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PBN1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
