| UniProt ID | AQY1_YEAST | |
|---|---|---|
| UniProt AC | P0CD91 | |
| Protein Name | Aquaporin-1 | |
| Gene Name | AQY1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 305 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. Cell membrane Multi-pass membrane protein. |
|
| Protein Description | Water channel required to facilitate the transport of water across membranes. Involved in sporulation, freeze tolerance and osmotolerance (By similarity). Is non-functional in most laboratory strains.. | |
| Protein Sequence | MSSNDSNDTDKQHTRLDPTGVDDAYIPPEQPETKHHRFKISRDTLRDHFIAAVGEFCGTFMFLWCAYVICNVANHDVALVAAPDGSHPGQLIMIAIGFGFSVMFSIWCFAGVSGGALNPAMSLSLCLARAVSPTRCVVMWVSQIVAGMAAGGAASAMTPGEVLFANSLGLGCSRTRGLFLEMFGTAILCLTVLMTAVEKRETNFMAALPIGISLFIAHVALTAYTGTGVNPARSLGAAVAARYFPHYHWIYWIGTLLGSILAWSVWQLLQILDYTTYVTAEKAASTKEKAQKKGETSSSSAVAEV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of AQY1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of AQY1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AQY1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AQY1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| PHO88_YEAST | PHO88 | physical | 16093310 | |
| ELO2_YEAST | ELO2 | physical | 16093310 | |
| YET1_YEAST | YET1 | physical | 16093310 | |
| GUP2_YEAST | GUP2 | physical | 16093310 | |
| AQY2_YEAST | AQY2 | genetic | 20369021 | |
| HUR1_YEAST | HUR1 | genetic | 27708008 | |
| TSA1_YEAST | TSA1 | genetic | 27708008 | |
| KASH5_HUMAN | CCDC155 | physical | 27107014 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
