UniProt ID | GMT2_YEAST | |
---|---|---|
UniProt AC | P0CE11 | |
Protein Name | Probable GDP-mannose transporter 2 | |
Gene Name | HVG1 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 249 | |
Subcellular Localization |
Golgi apparatus membrane Multi-pass membrane protein. Cytoplasmic vesicle membrane Multi-pass membrane protein. Endoplasmic reticulum membrane Multi-pass membrane protein. Recycles between the Golgi apparatus and the endoplasmic reticulum.. |
|
Protein Description | Involved in the import of GDP-mannose from the cytoplasm into the Golgi lumen.. | |
Protein Sequence | MIYTSSKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGKVTSMELTSFIMMVLSSVVATWGDQQAIAIKASSLEDLDQELVESTIFVLNPGYLWMFTNCISSALFVLIMRKRIRLTNFKDYDTMFYNNVLALPLLLVFSFIMEDWSTKNLSVNLSADSLAAMVISGLMSVGISYCSGWCVRVTSSTTYSMVGALNKLPIALAGLVFFDAPKNFLSFFSIFLGFLSGLLYAVAKQKKIQQQKVLAATLEK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
149 | N-linked_Glycosylation | MEDWSTKNLSVNLSA HCCCCCCCEECEECH | 37.32 | - | |
153 | N-linked_Glycosylation | STKNLSVNLSADSLA CCCCEECEECHHHHH | 25.54 | - | |
184 | Phosphorylation | GWCVRVTSSTTYSMV CEEEEEEECCCHHHH | 23.88 | 27017623 | |
188 | Phosphorylation | RVTSSTTYSMVGALN EEEECCCHHHHHHHH | 8.54 | 27017623 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GMT2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GMT2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GMT2_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...