dbPTM

YN8S_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YN8S_YEAST
UniProt AC	P53740
Protein Name	Probable phospholipid translocase non-catalytic subunit CRF1 {ECO:0000303\|PubMed:17093059}
Gene Name	YNR048W {ECO:0000312\|SGD:S000005331}
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	393
Subcellular Localization	Golgi apparatus, trans-Golgi network membrane Multi-pass membrane protein .
Protein Description	Potential non-catalytic subunit for a heteromeric phospholipid translocase (PLT) CRF1-DNF3, implicated in the translocation of phospholipids from the outer to the inner leaflet of membrane bilayers. Shares an essential function for cell growth with PLTs CDC50-DRS2 and LEM3-DNF1/2. May be involved in transport from early endosomes to the trans-Golgi network (TGN)..
Protein Sequence	MGLILRWKEKKQLSSKQNAQKSRKPANTSFRQQRLKAWQPILSPQSVLPLLILMACVFAPIGIGLVVSTISVQRLVVNYTECDALAPAKHFETIPSEYVDYHFSKKVAVQPQWMVLTDPELGNQTCRIQFEVPNHIKKSTYVYYRLTNFNQNYREYVQSLDLDQLKGKALIGNDLDPNCDPLRTVENKTIFPCGLIANSMFNDTFGTTLTGVNDTADYLLTTKGIAWDTDSHRYGKTEYNASDIVPPPNWAKLFPNGYTDDNIPDLQNWEQFKIWMRTAALPNFYKLAMKNETNGLGKGIYIADIELNYPVRSFYGTKSFVLTTNSIIGAGNEALGIVYLIVAGIATLFAILFLIKVIFKPRPMHDHSYLNFENSDTPFDESSVVSIPLREIL

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
78	N-linked_Glycosylation	SVQRLVVNYTECDAL CEEEEEEEHHHCCCC	30.45	-
123	N-linked_Glycosylation	LTDPELGNQTCRIQF ECCHHHCCCEEEEEE	46.76	-
187	N-linked_Glycosylation	DPLRTVENKTIFPCG CCCCCCCCCEECCCC	42.29	-
202	N-linked_Glycosylation	LIANSMFNDTFGTTL HHHHHHCCCCCCCCC	38.48	-
213	N-linked_Glycosylation	GTTLTGVNDTADYLL CCCCCCCCHHHCCEE	42.11	-
240	N-linked_Glycosylation	RYGKTEYNASDIVPP CCCCCCCCHHHCCCC	27.08	-
291	N-linked_Glycosylation	FYKLAMKNETNGLGK HHHHHHCCCCCCCCC	48.52	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YN8S_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YN8S_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YN8S_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CDC50_YEAST	CDC50	genetic	11180453
RT107_YEAST	RTT107	genetic	17314980
LSM7_YEAST	LSM7	genetic	17314980
RV161_YEAST	RVS161	genetic	17314980
ARD1_YEAST	ARD1	genetic	17314980
HDA1_YEAST	HDA1	genetic	17314980
ORM2_YEAST	ORM2	genetic	17314980
PRI1_YEAST	PRI1	genetic	17314980
ATC8_YEAST	DNF3	physical	19968326
LEM3_YEAST	LEM3	genetic	15090616
LEM3_YEAST	LEM3	genetic	11180453
SSB1_YEAST	SSB1	physical	22940862
HSP72_YEAST	SSA2	physical	22940862
GCN1_YEAST	GCN1	physical	22940862
HSP71_YEAST	SSA1	physical	22940862
PSD1_YEAST	PSD1	genetic	23891562
GET2_YEAST	GET2	genetic	23891562
COPB_YEAST	SEC26	genetic	23891562
TR130_YEAST	TRS130	genetic	23891562
PSS_YEAST	CHO1	genetic	24390140
ATC7_YEAST	NEO1	genetic	24390140
PSD2_YEAST	PSD2	genetic	24390140
SWC5_YEAST	SWC5	genetic	27708008
OSW7_YEAST	OSW7	genetic	27708008
RL37A_YEAST	RPL37A	genetic	27708008
HFA1_YEAST	HFA1	genetic	27708008
KAR3_YEAST	KAR3	genetic	27708008
ART5_YEAST	ART5	genetic	25781026
ITR1_YEAST	ITR1	genetic	25781026
ITR2_YEAST	ITR2	genetic	25781026
PSS_YEAST	CHO1	genetic	25781026

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YN8S_YEAST

Related Literatures of Post-Translational Modification