UniProt ID | YP098_YEAST | |
---|---|---|
UniProt AC | Q06089 | |
Protein Name | Uncharacterized mitochondrial outer membrane protein YPR098C | |
Gene Name | YPR098C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 161 | |
Subcellular Localization |
Mitochondrion outer membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MCLVKTTAHLLFYSFVFGGTTFYSYVASPIAFKVLEKDQFSALQNKIFPYFFQMQAASPVILALTAPIALTTGPLSSLVVASVSGLTNLFWLLPWTHKVKEQRKNIAKKYTGSELEAKDAILRKEFGKSHGLSLLFNLSNVCGMLAYGVCLSGGLLRKIPK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
37 | Acetylation | IAFKVLEKDQFSALQ HHHHHHCHHHHHHHH | 53.31 | 24489116 | |
109 | Ubiquitination | QRKNIAKKYTGSELE HHHHHHHHHCCCHHH | 38.74 | 23749301 | |
139 | Phosphorylation | LSLLFNLSNVCGMLA HHHHHCHHHHHHHHH | 28.46 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YP098_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YP098_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YP098_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-139, AND MASSSPECTROMETRY. |