YG1I_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YG1I_YEAST
• UniProt AC: P53217
• Protein Name: Uncharacterized membrane protein YGR026W
• Gene Name: YGR026W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 278
• Subcellular Localization: Cell membrane ; Multi-pass membrane protein .
• Protein Sequence: MAKTIKVIRKKDPKKKNLSDPLAKQKLVWKIGHVLTLVFGLLFSITYFYHVLIFFKYRSWKWLFLRVNKNYSFIQSKRWYMKLLSWSPQVMYRLSLIGVFMSESVTMQQNWVGLNPTWNDLLSSENFHTLLIACLWFFGGGKSFYKILPYMILSYLHLTKMNYELNANKEEKIPLTPKDRKMLHLLAYSELLVILALTLDTILFKTGTSGFMLVIYVGIYWLRLNFSPYAQVAVLELLVKFEKYVPKKYRDKWQVIKNFIYMKMKEHEKRTEEVARYA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
172	Acetylation	LNANKEEKIPLTPKD CCCCCCCCCCCCHHH	51.20	24489116
178	2-Hydroxyisobutyrylation	EKIPLTPKDRKMLHL CCCCCCHHHHHHHHH	66.00	-
201	Phosphorylation	ILALTLDTILFKTGT HHHHHHHHHHHHCCC	23.77	27017623
252	Acetylation	VPKKYRDKWQVIKNF CCHHHHHHHHHHHHH	30.44	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YG1I_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YG1I_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YG1I_YEAST !!

Protein-Protein Interaction

Oops, there are no PPI records of YG1I_YEAST !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.