ABM1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ABM1_YEAST
• UniProt AC: P47146
• Protein Name: Aberrant microtubules protein 1
• Gene Name: ABM1
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 123
• Protein Description: Required for normal microtubule organization..
• Protein Sequence: MSWRYSILTVDGSFKIFIPWEIFLTWNFLSAAWLNSTESNTYIHYSTCWGTSDYTLNISVIEATTEKLVDTRLLTTLENATAWINSNSIDEDEDDMPHATNVADRLDGLSLSKRVYSICHYEF

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MSWRYSILTVDGS --CCCEEEEEEECCC	11.53	28152593
9	Phosphorylation	SWRYSILTVDGSFKI CCEEEEEEECCCEEE	18.19	28152593
13	Phosphorylation	SILTVDGSFKIFIPW EEEEECCCEEEEEEH	20.92	28152593
110	Phosphorylation	ADRLDGLSLSKRVYS HHHCCCCCHHHCCHH	35.81	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ABM1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ABM1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ABM1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ERR1_YEAST	ERR1	physical	18467557
ERR2_YEAST	ERR1	physical	18467557
SMD1_YEAST	SMD1	genetic	27708008
CDC37_YEAST	CDC37	genetic	27708008
ACT_YEAST	ACT1	genetic	27708008
DAM1_YEAST	DAM1	genetic	27708008
SSL1_YEAST	SSL1	genetic	27708008
SEC22_YEAST	SEC22	genetic	27708008
RNA1_YEAST	RNA1	genetic	27708008
APC5_YEAST	APC5	genetic	27708008
RPN7_YEAST	RPN7	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.