YGK1_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: YGK1_YEAST
• UniProt AC: P53144
• Protein Name: HD domain-containing protein YGL101W
• Gene Name: YGL101W
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 215
• Protein Sequence: MTAVNIWKPEDNIPREILAILSKPHPNYQLAFLNIIQLLKTQRRTGWVDHGIDPCESISDHMYRMGLTTMLITDKNVDRNKCIRIALVHDFAESLVGDITPNDPMTKEEKHRREFETVKYLCESIIRPCSESASREILDDWLAYEKQTCLEGRYVKDIDKYEMLVQCFEYEQKYNGKKDLKQFLGAINDIKTDEVKKWTQSLLEDRQAFFDSLKE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
146	Ubiquitination	DDWLAYEKQTCLEGR HHHHHHHHHHHHCCC	37.93	23749301

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of YGK1_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of YGK1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of YGK1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SWC5_YEAST	SWC5	genetic	27708008
MGR1_YEAST	MGR1	genetic	27708008
GPR1_YEAST	GPR1	genetic	27708008
RAD57_YEAST	RAD57	genetic	27708008
ASK10_YEAST	ASK10	genetic	27708008
RL16A_YEAST	RPL16A	genetic	27708008
GTR1_YEAST	GTR1	genetic	27708008
SFG1_YEAST	SFG1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.