UniProt ID | GAT3_YEAST | |
---|---|---|
UniProt AC | Q07928 | |
Protein Name | Protein GAT3 | |
Gene Name | GAT3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 141 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MNIKTLCHPEYKRISVESLLNPVEETIDCEKPHSQTKINTAKPISASLYVTTNNTAVVQHNVQKRKGVTRRCPQCAVIKTSPQWREGPDGEVTLCNACGLFYRKIFLVFGKDLAKRYFNEIKGVSVKRKVPKSLYGVTRTR | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GAT3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GAT3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GAT3_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SSD1_YEAST | SSD1 | genetic | 20093466 | |
PLMT_YEAST | OPI3 | genetic | 20093466 | |
ARL3_YEAST | ARL3 | genetic | 20093466 | |
SIN3_YEAST | SIN3 | genetic | 20959818 | |
SUT2_YEAST | SUT2 | genetic | 20959818 | |
HOS2_YEAST | HOS2 | genetic | 20959818 | |
DCC1_YEAST | DCC1 | genetic | 21127252 | |
THRC_YEAST | THR4 | genetic | 27708008 | |
MAF1_YEAST | MAF1 | genetic | 27708008 | |
LSM6_YEAST | LSM6 | genetic | 27708008 | |
MRM2_YEAST | MRM2 | genetic | 27708008 | |
BRR1_YEAST | BRR1 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...