GAT3_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GAT3_YEAST
• UniProt AC: Q07928
• Protein Name: Protein GAT3
• Gene Name: GAT3
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 141
• Protein Sequence: MNIKTLCHPEYKRISVESLLNPVEETIDCEKPHSQTKINTAKPISASLYVTTNNTAVVQHNVQKRKGVTRRCPQCAVIKTSPQWREGPDGEVTLCNACGLFYRKIFLVFGKDLAKRYFNEIKGVSVKRKVPKSLYGVTRTR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
104	Ubiquitination	ACGLFYRKIFLVFGK HHHCHHHHHHHHHCH	26.82	17644757
125	Phosphorylation	FNEIKGVSVKRKVPK HHHCCCCEEEECCCH	30.50	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GAT3_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GAT3_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GAT3_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SSD1_YEAST	SSD1	genetic	20093466
PLMT_YEAST	OPI3	genetic	20093466
ARL3_YEAST	ARL3	genetic	20093466
SIN3_YEAST	SIN3	genetic	20959818
SUT2_YEAST	SUT2	genetic	20959818
HOS2_YEAST	HOS2	genetic	20959818
DCC1_YEAST	DCC1	genetic	21127252
THRC_YEAST	THR4	genetic	27708008
MAF1_YEAST	MAF1	genetic	27708008
LSM6_YEAST	LSM6	genetic	27708008
MRM2_YEAST	MRM2	genetic	27708008
BRR1_YEAST	BRR1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.