| UniProt ID | YDC1_YEAST | |
|---|---|---|
| UniProt AC | Q02896 | |
| Protein Name | Alkaline ceramidase YDC1 | |
| Gene Name | YDC1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 317 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein. Golgi apparatus membrane Multi-pass membrane protein. |
|
| Protein Description | Catalyzes the conversion of dihydroceramide and also phytoceramide to dihydrosphingosine or phytosphingosine. Prefers dihydroceramide. Very low reverse hydrolysis activity, catalyzing synthesis of dihydroceramide from fatty acid and dihydrosphingosine. Is not responsible for the breakdown of unsaturated ceramide. May play a role in heat stress response.. | |
| Protein Sequence | MLFSWPYPEAPIEGYWGKPTSLIDWCEENYVVSPYIAEWSNTITNSIFLMTAFYSTYSAWRNKLETRYILIGMGFSLVGIGSWLFHMTLQYRYQLLDELPMLYATIIPSWSIFAETQEILIKDEKKRKESSFRIQMVISFIMCGIVTILTWIYVVVQKPAIFQVLYGILTLLVVVLSGWLTYYHVHDSFAKKNLFITMVMGMIPFVIGFICWQLDIHLCSFWIYIRRTYLALPLGVLLELHAWWHLLTGTGVYIFVVYLQYLRILTHGNPNDFLFIWRWGFFPELVRKGLPIGTSYSLEYLGPIVNTQVDDETKKNN | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YDC1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YDC1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YDC1_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| ARL3_YEAST | ARL3 | genetic | 16269340 | |
| MNL1_YEAST | MNL1 | genetic | 16269340 | |
| ALG5_YEAST | ALG5 | physical | 18467557 | |
| PLSC_YEAST | SLC1 | genetic | 21173150 | |
| CSG2_YEAST | CSG2 | genetic | 21623372 | |
| SCS7_YEAST | SCS7 | genetic | 21623372 | |
| FOLE_YEAST | MET7 | genetic | 21623372 | |
| THRC_YEAST | THR4 | genetic | 21623372 | |
| GFD2_YEAST | GFD2 | genetic | 27708008 | |
| MGR1_YEAST | MGR1 | genetic | 27708008 | |
| BUD31_YEAST | BUD31 | genetic | 27708008 | |
| TPS2_YEAST | TPS2 | genetic | 27708008 | |
| RLA4_YEAST | RPP2B | genetic | 27708008 | |
| RAD4_YEAST | RAD4 | genetic | 27708008 | |
| HSE1_YEAST | HSE1 | genetic | 27708008 | |
| YIA6_YEAST | YIA6 | genetic | 27708008 | |
| THIK_YEAST | POT1 | genetic | 27708008 | |
| PIR5_YEAST | YJL160C | genetic | 27708008 | |
| MMM1_YEAST | MMM1 | genetic | 27708008 | |
| NKP2_YEAST | NKP2 | genetic | 27708008 | |
| VPS9_YEAST | VPS9 | genetic | 27708008 | |
| SCS7_YEAST | SCS7 | genetic | 27708008 | |
| MAS5_YEAST | YDJ1 | genetic | 27708008 | |
| MSB4_YEAST | MSB4 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
