| UniProt ID | FAR3_YEAST | |
|---|---|---|
| UniProt AC | P46671 | |
| Protein Name | Factor arrest protein 3 | |
| Gene Name | FAR3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 204 | |
| Subcellular Localization | Endoplasmic reticulum . | |
| Protein Description | Participates in the control of the reentry into the cell cycle following pheromone treatment.. | |
| Protein Sequence | MNSGGSDSFDYLLQLTKALSAECRANRQETDRIELLLKRLAKQSGISYDNLSKNIIPDSWKDNASQKASPPTEAQKLISENFKLIYEIEKQEYFNTKAVALINNINEHFSYIKNFIDEQNAIRERNIATFSSEKLDERNKSLQQNYESLKTENEETKKKLHSIIKQFEKLLKEVDWDRISKDSRDYSRFKKQLEYLQDTYQVLK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 52 | Phosphorylation | GISYDNLSKNIIPDS CCCHHCCCCCCCCCH | 29.88 | 28889911 | |
| 69 | Phosphorylation | DNASQKASPPTEAQK CCCCCCCCCCHHHHH | 38.15 | 23749301 | |
| 141 | Phosphorylation | KLDERNKSLQQNYES HHHHHHHHHHHHHHH | 34.65 | 28889911 | |
| 146 | Phosphorylation | NKSLQQNYESLKTEN HHHHHHHHHHHHCCC | 11.53 | 28889911 | |
| 148 | Phosphorylation | SLQQNYESLKTENEE HHHHHHHHHHCCCHH | 25.47 | 28889911 | |
| 165 | Acetylation | KKLHSIIKQFEKLLK HHHHHHHHHHHHHHH | 47.46 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FAR3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FAR3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FAR3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
