UniProt ID | FAR3_YEAST | |
---|---|---|
UniProt AC | P46671 | |
Protein Name | Factor arrest protein 3 | |
Gene Name | FAR3 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 204 | |
Subcellular Localization | Endoplasmic reticulum . | |
Protein Description | Participates in the control of the reentry into the cell cycle following pheromone treatment.. | |
Protein Sequence | MNSGGSDSFDYLLQLTKALSAECRANRQETDRIELLLKRLAKQSGISYDNLSKNIIPDSWKDNASQKASPPTEAQKLISENFKLIYEIEKQEYFNTKAVALINNINEHFSYIKNFIDEQNAIRERNIATFSSEKLDERNKSLQQNYESLKTENEETKKKLHSIIKQFEKLLKEVDWDRISKDSRDYSRFKKQLEYLQDTYQVLK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
52 | Phosphorylation | GISYDNLSKNIIPDS CCCHHCCCCCCCCCH | 29.88 | 28889911 | |
69 | Phosphorylation | DNASQKASPPTEAQK CCCCCCCCCCHHHHH | 38.15 | 23749301 | |
141 | Phosphorylation | KLDERNKSLQQNYES HHHHHHHHHHHHHHH | 34.65 | 28889911 | |
146 | Phosphorylation | NKSLQQNYESLKTEN HHHHHHHHHHHHCCC | 11.53 | 28889911 | |
148 | Phosphorylation | SLQQNYESLKTENEE HHHHHHHHHHCCCHH | 25.47 | 28889911 | |
165 | Acetylation | KKLHSIIKQFEKLLK HHHHHHHHHHHHHHH | 47.46 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FAR3_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FAR3_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FAR3_YEAST !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...