| UniProt ID | EDC1_YEAST | |
|---|---|---|
| UniProt AC | P53080 | |
| Protein Name | Enhancer of mRNA-decapping protein 1 | |
| Gene Name | EDC1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 175 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | mRNA-binding protein which stimulates mRNA decapping by DCP1 and DCP2. Involved in the regulation of expression of multiple genes involved in glycolysis and gluconeogenesis.. | |
| Protein Sequence | MSTDTMYFNSSRLLPSAGRNKTNNLIKQKTRNNRARGNAAKNANNNNYITDIPPPQTLPNGQKPNFGHSSNKKPSFNQKKHSPPSSPSSTTTLGKKNRQNNKETPRQNNKDDTRLLSQNLKNLLLNQKQSPHGSQGIIPMGCNGSAKKLSHSYAGSTFATNGPREAKNLPKPSFL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MSTDTMYFN ------CCCCCCCCC | 34.68 | 22814378 | |
| 5 | Phosphorylation | ---MSTDTMYFNSSR ---CCCCCCCCCHHH | 17.54 | 30377154 | |
| 7 | Phosphorylation | -MSTDTMYFNSSRLL -CCCCCCCCCHHHCC | 11.16 | 30377154 | |
| 16 | Phosphorylation | NSSRLLPSAGRNKTN CHHHCCCCCCCCHHH | 43.24 | 27017623 | |
| 75 | Phosphorylation | HSSNKKPSFNQKKHS CCCCCCCCCCCCCCC | 45.79 | 28889911 | |
| 82 | Phosphorylation | SFNQKKHSPPSSPSS CCCCCCCCCCCCCCC | 47.59 | ||
| 85 | Phosphorylation | QKKHSPPSSPSSTTT CCCCCCCCCCCCCCC | 59.26 | 22369663 | |
| 86 | Phosphorylation | KKHSPPSSPSSTTTL CCCCCCCCCCCCCCC | 34.28 | 22369663 | |
| 88 | Phosphorylation | HSPPSSPSSTTTLGK CCCCCCCCCCCCCCH | 42.12 | 22890988 | |
| 89 | Phosphorylation | SPPSSPSSTTTLGKK CCCCCCCCCCCCCHH | 32.91 | 22890988 | |
| 90 | Phosphorylation | PPSSPSSTTTLGKKN CCCCCCCCCCCCHHC | 28.30 | 22890988 | |
| 91 | Phosphorylation | PSSPSSTTTLGKKNR CCCCCCCCCCCHHCC | 23.21 | 22890988 | |
| 92 | Phosphorylation | SSPSSTTTLGKKNRQ CCCCCCCCCCHHCCC | 33.33 | 22890988 | |
| 130 | Phosphorylation | LLLNQKQSPHGSQGI HHHCCCCCCCCCCCE | 26.37 | 19779198 | |
| 145 | Phosphorylation | IPMGCNGSAKKLSHS ECCCCCCCCCCCCCC | 23.95 | 19779198 | |
| 150 | Phosphorylation | NGSAKKLSHSYAGST CCCCCCCCCCCCCCC | 21.19 | 21440633 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EDC1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EDC1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EDC1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "A multidimensional chromatography technology for in-depthphosphoproteome analysis."; Albuquerque C.P., Smolka M.B., Payne S.H., Bafna V., Eng J., Zhou H.; Mol. Cell. Proteomics 7:1389-1396(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, AND MASSSPECTROMETRY. | |
| "Proteome-wide identification of in vivo targets of DNA damagecheckpoint kinases."; Smolka M.B., Albuquerque C.P., Chen S.H., Zhou H.; Proc. Natl. Acad. Sci. U.S.A. 104:10364-10369(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82 AND SER-86, AND MASSSPECTROMETRY. | |
| "Analysis of phosphorylation sites on proteins from Saccharomycescerevisiae by electron transfer dissociation (ETD) massspectrometry."; Chi A., Huttenhower C., Geer L.Y., Coon J.J., Syka J.E.P., Bai D.L.,Shabanowitz J., Burke D.J., Troyanskaya O.G., Hunt D.F.; Proc. Natl. Acad. Sci. U.S.A. 104:2193-2198(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82 AND SER-86, AND MASSSPECTROMETRY. | |
