dbPTM

YP162_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	YP162_YEAST
UniProt AC	Q12042
Protein Name	Vacuolar membrane protein YPL162C
Gene Name	YPL162C
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	273
Subcellular Localization	Vacuole membrane Multi-pass membrane protein .
Protein Description
Protein Sequence	MYVSNGKDTCQLLGPVSLFVQTLMGMTAVIVLLVKRNYEHPRRKMIVWSYDIGKQIIGSLGIHFLNLGISILKKRRRSLFAITAKGNDDEDQCDWYFLNLLLDTTVGIPILWLCLYIIEKVLKSLHFQNIESGNYFPSKTVGSHPRKPLFSAFVKQLLIFIVGLGVMKFCVFLILNYLEDLAYWFADLILGWSDSWPNFQVFLVMFVFPILLNCFQYFCVDNVIRLHSESLTITNAENFETNTFLNDEIPDLSEVSNEVPNKDNNISSYGSII

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of YP162_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of YP162_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of YP162_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of YP162_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TMN1_YEAST	EMP70	physical	16093310
BUD31_YEAST	BUD31	genetic	27708008
PEX5_YEAST	PEX5	genetic	27708008
YJQ3_YEAST	YJL163C	genetic	27708008
VPS9_YEAST	VPS9	genetic	27708008
FRE7_YEAST	FRE7	genetic	27708008

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of YP162_YEAST

Related Literatures of Post-Translational Modification