UniProt ID | YP162_YEAST | |
---|---|---|
UniProt AC | Q12042 | |
Protein Name | Vacuolar membrane protein YPL162C | |
Gene Name | YPL162C | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 273 | |
Subcellular Localization |
Vacuole membrane Multi-pass membrane protein . |
|
Protein Description | ||
Protein Sequence | MYVSNGKDTCQLLGPVSLFVQTLMGMTAVIVLLVKRNYEHPRRKMIVWSYDIGKQIIGSLGIHFLNLGISILKKRRRSLFAITAKGNDDEDQCDWYFLNLLLDTTVGIPILWLCLYIIEKVLKSLHFQNIESGNYFPSKTVGSHPRKPLFSAFVKQLLIFIVGLGVMKFCVFLILNYLEDLAYWFADLILGWSDSWPNFQVFLVMFVFPILLNCFQYFCVDNVIRLHSESLTITNAENFETNTFLNDEIPDLSEVSNEVPNKDNNISSYGSII | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of YP162_YEAST !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YP162_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YP162_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YP162_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TMN1_YEAST | EMP70 | physical | 16093310 | |
BUD31_YEAST | BUD31 | genetic | 27708008 | |
PEX5_YEAST | PEX5 | genetic | 27708008 | |
YJQ3_YEAST | YJL163C | genetic | 27708008 | |
VPS9_YEAST | VPS9 | genetic | 27708008 | |
FRE7_YEAST | FRE7 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...