| UniProt ID | YE17_YEAST | |
|---|---|---|
| UniProt AC | P40102 | |
| Protein Name | Uncharacterized protein YER187W | |
| Gene Name | YER187W | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 141 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MLIDQIVAAVPGVPDISGNASALSLQRRSQEFATSWISMTYSQSYGDLAQNWQNDEGGAGNFDSYAEEKLQNFFSGNRDWKYCFAAEDTKNGEPLDYDDIPGDGAGTGSAFKSEIYFNTYGGIDNYCNDEHIGAQNTGDGR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | VPGVPDISGNASALS CCCCCCCCCCHHHHH | 33.12 | 28889911 | |
| 21 | Phosphorylation | PDISGNASALSLQRR CCCCCCHHHHHHHHH | 33.47 | 28889911 | |
| 24 | Phosphorylation | SGNASALSLQRRSQE CCCHHHHHHHHHHHH | 23.36 | 28889911 | |
| 89 | Phosphorylation | YCFAAEDTKNGEPLD EEEEEECCCCCCCCC | 20.22 | 19684113 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YE17_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YE17_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YE17_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
