| UniProt ID | RDL2_YEAST | |
|---|---|---|
| UniProt AC | Q08742 | |
| Protein Name | Thiosulfate sulfurtransferase RDL2, mitochondrial | |
| Gene Name | RDL2 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 149 | |
| Subcellular Localization | Mitochondrion . | |
| Protein Description | Thiosulfate sulfurtransferase which catalyzes the transfer of sulfane sulfur from thiosulfate to cyanide.. | |
| Protein Sequence | MFKHSTGILSRTVSARSPTLVLRTFTTKAPKIYTFDQVRNLVEHPNDKKLLVDVREPKEVKDYKMPTTINIPVNSAPGALGLPEKEFHKVFQFAKPPHDKELIFLCAKGVRAKTAEELARSYGYENTGIYPGSITEWLAKGGADVKPKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 17 | Phosphorylation | SRTVSARSPTLVLRT HCCCCCCCCEEEEEE | 23.19 | 21440633 | |
| 19 | Phosphorylation | TVSARSPTLVLRTFT CCCCCCCEEEEEEEC | 30.64 | 27017623 | |
| 26 | Phosphorylation | TLVLRTFTTKAPKIY EEEEEEECCCCCEEE | 27.12 | 27017623 | |
| 27 | Phosphorylation | LVLRTFTTKAPKIYT EEEEEECCCCCEEEE | 22.48 | 27017623 | |
| 31 | Acetylation | TFTTKAPKIYTFDQV EECCCCCEEEEHHHH | 53.88 | 24489116 | |
| 33 | Phosphorylation | TTKAPKIYTFDQVRN CCCCCEEEEHHHHHH | 13.89 | 22369663 | |
| 34 | Phosphorylation | TKAPKIYTFDQVRNL CCCCEEEEHHHHHHH | 24.98 | 22369663 | |
| 58 | Acetylation | LVDVREPKEVKDYKM EEECCCCCCCCCCCC | 71.09 | 24489116 | |
| 85 | Acetylation | GALGLPEKEFHKVFQ CCCCCCHHHHHHHHH | 64.83 | 24489116 | |
| 95 | Acetylation | HKVFQFAKPPHDKEL HHHHHHCCCCCCHHH | 61.44 | 22865919 | |
| 127 | Phosphorylation | RSYGYENTGIYPGSI HHHCCCCCCCCCCCH | 17.02 | 19779198 | |
| 130 | Phosphorylation | GYENTGIYPGSITEW CCCCCCCCCCCHHHH | 11.68 | 29650682 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RDL2_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RDL2_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RDL2_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| THRC_YEAST | THR4 | genetic | 27708008 | |
| YCY0_YEAST | YCR090C | genetic | 27708008 | |
| MCFS2_YEAST | EHT1 | genetic | 27708008 | |
| PYC2_YEAST | PYC2 | genetic | 27708008 | |
| GPR1_YEAST | GPR1 | genetic | 27708008 | |
| SAK1_YEAST | SAK1 | genetic | 27708008 | |
| DAK2_YEAST | DAK2 | genetic | 27708008 | |
| ASF1_YEAST | ASF1 | genetic | 27708008 | |
| TDA4_YEAST | TDA4 | genetic | 27708008 | |
| FRE8_YEAST | FRE8 | genetic | 27708008 | |
| ERG3_YEAST | ERG3 | genetic | 27708008 | |
| ENV10_YEAST | ENV10 | genetic | 27708008 | |
| BOP2_YEAST | BOP2 | genetic | 27708008 | |
| ARPC3_YEAST | ARC18 | genetic | 27708008 | |
| TSA1_YEAST | TSA1 | genetic | 27708008 | |
| VBA1_YEAST | VBA1 | genetic | 27708008 | |
| YM8F_YEAST | YMR265C | genetic | 27708008 | |
| IRA2_YEAST | IRA2 | genetic | 27708008 | |
| INO4_YEAST | INO4 | genetic | 27708008 | |
| WHI5_YEAST | WHI5 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...