UniProt ID | YJO4_YEAST | |
---|---|---|
UniProt AC | P47009 | |
Protein Name | Uncharacterized protein YJL144W | |
Gene Name | YJL144W | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 104 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MLRRETSTIYRTHKKSNSSILRSQRDQTRVDSLVEESPMGDFGINNQPTQPGVIYYFVELTNLGIQENTSSNNNNNNNHGDDENGSRYGHGSSLGGDVHSRRCS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
71 | Phosphorylation | GIQENTSSNNNNNNN CEECCCCCCCCCCCC | 41.35 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of YJO4_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of YJO4_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of YJO4_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CLU_YEAST | CLU1 | physical | 16554755 | |
MCM1_YEAST | MCM1 | genetic | 27708008 | |
POP7_YEAST | POP7 | genetic | 27708008 | |
RSC6_YEAST | RSC6 | genetic | 27708008 | |
TECR_YEAST | TSC13 | genetic | 27708008 | |
RMRP_YEAST | SNM1 | genetic | 27708008 | |
MOB2_YEAST | MOB2 | genetic | 27708008 | |
ACT_YEAST | ACT1 | genetic | 27708008 | |
SMD1_YEAST | SMD1 | genetic | 27708008 | |
TAF1_YEAST | TAF1 | genetic | 27708008 | |
IF2A_YEAST | SUI2 | genetic | 27708008 | |
ARP3_YEAST | ARP3 | genetic | 27708008 | |
CDC11_YEAST | CDC11 | genetic | 27708008 | |
GSP1_YEAST | GSP1 | genetic | 27708008 | |
AFG2_YEAST | AFG2 | genetic | 27708008 | |
HAS1_YEAST | HAS1 | genetic | 27708008 | |
RLP7_YEAST | RLP7 | genetic | 27708008 | |
NOG2_YEAST | NOG2 | genetic | 27708008 | |
SGT1_YEAST | SGT1 | genetic | 27708008 | |
APC5_YEAST | APC5 | genetic | 27708008 | |
IF6_YEAST | TIF6 | genetic | 27708008 | |
TRI41_HUMAN | TRIM41 | physical | 27107014 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...