dbPTM

FTHC_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	FTHC_YEAST
UniProt AC	P40099
Protein Name	5-formyltetrahydrofolate cyclo-ligase
Gene Name	FAU1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	211
Subcellular Localization	Mitochondrion .
Protein Description	Only enzyme known to utilize 5-formyltetrahydrofolate (folinic acid) as substrate. Contributes to tetrahydrofolate metabolism in an alternative way of folate biosynthesis. May regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids..
Protein Sequence	MATKQLLRRQIKRVINALDYDIIAAESHTISQAVRSLIASANSRRVACYMSMDKGEVTTGEIIKNLFQDGQEVFLPRCTHTSESKHFKLREDHHPHLIFHRMSSLKMVRDLKPQGPYQLKEPEPHIEESDILDVVLVPGVAFDIKTGARMGHGAGYYDDFFQRYKILHEGQKPLLVGLCLMEQVASPIPLEKHDYSMDCIVCGDGSIHWFQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of FTHC_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of FTHC_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of FTHC_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of FTHC_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PUR3_YEAST	ADE8	genetic	25893566
HIS1_YEAST	HIS1	genetic	25893566
BAS1_YEAST	BAS1	genetic	25893566
METE_YEAST	MET6	genetic	25893566
GLYC_YEAST	SHM2	genetic	25893566
CHK1_YEAST	CHK1	genetic	27708008
DOT1_YEAST	DOT1	genetic	27708008
DCAM_YEAST	SPE2	genetic	27708008
MYOTI_HUMAN	MYOT	physical	27107014
HEM1_HUMAN	ALAS1	physical	27107014

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of FTHC_YEAST

Related Literatures of Post-Translational Modification