| UniProt ID | PMG3_YEAST | |
|---|---|---|
| UniProt AC | Q12326 | |
| Protein Name | Phosphoglycerate mutase 3 | |
| Gene Name | GPM3 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 303 | |
| Subcellular Localization | ||
| Protein Description | Could be non-functional.. | |
| Protein Sequence | MTVTDTFKLFILRHGQSELNSENIFCGWIDAQLTEKGKSQARHSAKLIKQFCDSNNISLPQIGYTSRLIRTQQTMDVILEELGLKHTNYVITTNTNIKEELQDTRFEGSMPVLQTWRLNERHYGAWQGQRKPDILKEYGKEKYMYIRRDYNGKPPKVNLNLEMVQEENDQGSSTGYDFKEPNRHLKYGPEEKANERLPESESLCEVVVRLKPFLNNVVLSTANKISQESCVIVGHGSSVRSLLKVLEGISDEDIKDVDIPNGIPLVIELDRDNYSFVRKFYLDPESAKVNAQMVRDEGFEKNP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 36 | Ubiquitination | IDAQLTEKGKSQARH EHHHHHHHHHHHHHH | 67.42 | 17644757 | |
| 38 | Ubiquitination | AQLTEKGKSQARHSA HHHHHHHHHHHHHHH | 50.92 | 17644757 | |
| 49 | Ubiquitination | RHSAKLIKQFCDSNN HHHHHHHHHHHHCCC | 48.00 | 17644757 | |
| 85 | Ubiquitination | ILEELGLKHTNYVIT HHHHHCCCCCCEEEE | 46.73 | 17644757 | |
| 89 | Phosphorylation | LGLKHTNYVITTNTN HCCCCCCEEEECCCC | 8.39 | 28889911 | |
| 92 | Phosphorylation | KHTNYVITTNTNIKE CCCCEEEECCCCHHH | 12.16 | 28889911 | |
| 93 | Phosphorylation | HTNYVITTNTNIKEE CCCEEEECCCCHHHH | 28.99 | 28889911 | |
| 95 | Phosphorylation | NYVITTNTNIKEELQ CEEEECCCCHHHHHH | 35.91 | 28889911 | |
| 98 | Ubiquitination | ITTNTNIKEELQDTR EECCCCHHHHHHHCC | 47.40 | 17644757 | |
| 131 | Ubiquitination | GAWQGQRKPDILKEY CCCCCCCCCHHHHHH | 38.87 | 17644757 | |
| 136 | Ubiquitination | QRKPDILKEYGKEKY CCCCHHHHHHCCCEE | 49.58 | 17644757 | |
| 140 | Ubiquitination | DILKEYGKEKYMYIR HHHHHHCCCEEEEEE | 50.56 | 17644757 | |
| 156 | Ubiquitination | DYNGKPPKVNLNLEM CCCCCCCCCCEEEEE | 52.89 | 24961812 | |
| 172 | Phosphorylation | QEENDQGSSTGYDFK EECCCCCCCCCCCCC | 21.06 | 24961812 | |
| 173 | Phosphorylation | EENDQGSSTGYDFKE ECCCCCCCCCCCCCC | 32.45 | 24961812 | |
| 174 | Phosphorylation | ENDQGSSTGYDFKEP CCCCCCCCCCCCCCC | 41.27 | 24961812 | |
| 192 | Ubiquitination | LKYGPEEKANERLPE CCCCHHHHHHHCCCC | 55.65 | 17644757 | |
| 211 | Ubiquitination | CEVVVRLKPFLNNVV HHHHHHHHHHHCHHH | 24.14 | 17644757 | |
| 224 | Ubiquitination | VVLSTANKISQESCV HHHHCCCCCCCCCCE | 41.07 | 17644757 | |
| 244 | Ubiquitination | SSVRSLLKVLEGISD HHHHHHHHHHCCCCH | 50.49 | 17644757 | |
| 255 | Ubiquitination | GISDEDIKDVDIPNG CCCHHHCCCCCCCCC | 65.11 | 17644757 | |
| 279 | Ubiquitination | DNYSFVRKFYLDPES CCCCEEEHHCCCHHH | 32.81 | 17644757 | |
| 288 | Ubiquitination | YLDPESAKVNAQMVR CCCHHHHHCCHHHHH | 45.35 | 17644757 | |
| 301 | Ubiquitination | VRDEGFEKNP----- HHCCCCCCCC----- | 72.72 | 17644757 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PMG3_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PMG3_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PMG3_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
