| UniProt ID | DCP1_YEAST | |
|---|---|---|
| UniProt AC | Q12517 | |
| Protein Name | mRNA-decapping enzyme subunit 1 | |
| Gene Name | DCP1 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 231 | |
| Subcellular Localization | Cytoplasm, P-body . Is concentrated in several cytoplasmic foci called P bodies (or cytoplasmic processing bodies) which represent sites of mRNA decapping and 5' to 3' exonucleotidic decay. | |
| Protein Description | Component of the decapping complex necessary for the degradation of mRNAs, both in normal mRNA turnover and in nonsense-mediated mRNA decay. Removes the 7-methyl guanine cap structure from mRNA molecules, yielding a 5'-phosphorylated mRNA fragment and 7m-GDP. Decapping is the major pathway of mRNA degradation in yeast. It occurs through deadenylation, decapping and subsequent 5' to 3' exonucleolytic decay of the transcript body. DCP1 is activated by the DEAD-box helicase DHH1 and destabilizes the eIF-4F cap-binding complex from the mRNA.. | |
| Protein Sequence | MTGAATAAENSATQLEFYRKALNFNVIGRYDPKIKQLLFHTPHASLYKWDFKKDEWNKLEYQGVLAIYLRDVSQNTNLLPVSPQEVDIFDSQNGSNNIQVNNGSDNSNRNSSGNGNSYKSNDSLTYNCGKTLSGKDIYNYGLIILNRINPDNFSMGIVPNSVVNKRKVFNAEEDTLNPLECMGVEVKDELVIIKNLKHEVYGIWIHTVSDRQNIYELIKYLLENEPKDSFA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTGAATAAE ------CCCCCHHHC | 35.21 | 30377154 | |
| 6 | Phosphorylation | --MTGAATAAENSAT --CCCCCHHHCCHHH | 26.35 | 30377154 | |
| 11 | Phosphorylation | AATAAENSATQLEFY CCHHHCCHHHHHHHH | 24.97 | 30377154 | |
| 13 | Phosphorylation | TAAENSATQLEFYRK HHHCCHHHHHHHHHH | 33.24 | 30377154 | |
| 18 | Phosphorylation | SATQLEFYRKALNFN HHHHHHHHHHHHCCC | 11.22 | 30377154 | |
| 20 | Ubiquitination | TQLEFYRKALNFNVI HHHHHHHHHHCCCCC | 45.93 | 23749301 | |
| 111 | Phosphorylation | SDNSNRNSSGNGNSY CCCCCCCCCCCCCCC | 36.06 | 28889911 | |
| 112 | Phosphorylation | DNSNRNSSGNGNSYK CCCCCCCCCCCCCCC | 39.57 | 28889911 | |
| 118 | Phosphorylation | SSGNGNSYKSNDSLT CCCCCCCCCCCCCCE | 23.57 | 23749301 | |
| 119 | Ubiquitination | SGNGNSYKSNDSLTY CCCCCCCCCCCCCEE | 42.47 | 23749301 | |
| 120 | Phosphorylation | GNGNSYKSNDSLTYN CCCCCCCCCCCCEEC | 37.32 | 23749301 | |
| 123 | Phosphorylation | NSYKSNDSLTYNCGK CCCCCCCCCEECCCC | 27.19 | 28889911 | |
| 130 | Ubiquitination | SLTYNCGKTLSGKDI CCEECCCCCCCCCCC | 48.79 | 23749301 | |
| 135 | Ubiquitination | CGKTLSGKDIYNYGL CCCCCCCCCCCCCEE | 37.26 | 22817900 | |
| 165 | Ubiquitination | VPNSVVNKRKVFNAE CCCCHHCCCCCCCCC | 41.82 | 24961812 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DCP1_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DCP1_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DCP1_YEAST !! | ||||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
