| UniProt ID | RIB7_YEAST | |
|---|---|---|
| UniProt AC | P33312 | |
| Protein Name | 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate reductase | |
| Gene Name | RIB7 | |
| Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
| Sequence Length | 244 | |
| Subcellular Localization | ||
| Protein Description | Catalyzes an early step in riboflavin biosynthesis, the NADPH-dependent reduction of the ribose side chain of 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate, yielding 2,5-diamino-6-ribitylamino-4(3H)-pyrimidinone 5'-phosphate.. | |
| Protein Sequence | MSLTPLCEDLPQFLQNYLPNAGQTENTIVPFVTLTYAQSLDARVSRGPGVRTTISHPETKTMTHYLRHHHDGILVGSGTVLADNPGLNCKWGPDPAANSPRPIIIDTKQKWRFDGSKMQELFIKRQGKPPIVVVTSEPIIKEQHVDYAICPINDTTKLVDWKKLFEILKEEFNIRSVMVEGGANVINQLLLRSDIVNSLIITIGSTFLGSSGTEVSPPQTVNLKDMSWWKGITDVVLCARLADD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 60 | Acetylation | TISHPETKTMTHYLR EEECCCCHHHHHHHH | 34.34 | 24489116 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RIB7_YEAST !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RIB7_YEAST !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RIB7_YEAST !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RIB7_YEAST | RIB7 | physical | 18719252 | |
| RIB7_YEAST | RIB7 | physical | 23620735 | |
| PRP9_YEAST | PRP9 | genetic | 27708008 | |
| INO4_YEAST | INO4 | genetic | 27708008 | |
| ACT_YEAST | ACT1 | genetic | 27708008 | |
| ORC6_YEAST | ORC6 | genetic | 27708008 | |
| TFC8_YEAST | TFC8 | genetic | 27708008 | |
| NAB3_YEAST | NAB3 | genetic | 27708008 | |
| RPN7_YEAST | RPN7 | genetic | 27708008 | |
| SLX5_YEAST | SLX5 | genetic | 27708008 | |
| BRE1_YEAST | BRE1 | genetic | 27708008 | |
| RL13A_YEAST | RPL13A | genetic | 27708008 | |
| YG036_YEAST | YGL036W | genetic | 27708008 | |
| MDM34_YEAST | MDM34 | genetic | 27708008 | |
| RME1_YEAST | RME1 | genetic | 27708008 | |
| TNA1_YEAST | TNA1 | genetic | 27708008 | |
| ILM1_YEAST | ILM1 | genetic | 27708008 | |
| CTK1_YEAST | CTK1 | genetic | 27708008 | |
| SAC1_YEAST | SAC1 | genetic | 27708008 | |
| ALAM_YEAST | ALT1 | genetic | 27708008 | |
| LSM7_YEAST | LSM7 | genetic | 27708008 | |
| PFD4_YEAST | GIM3 | genetic | 27708008 | |
| RS10A_YEAST | RPS10A | genetic | 27708008 | |
| RAD1_YEAST | RAD1 | genetic | 27708008 | |
| GGPPS_YEAST | BTS1 | genetic | 27708008 | |
| BEM4_YEAST | BEM4 | genetic | 27708008 | |
| RU2A_YEAST | LEA1 | genetic | 27708008 | |
| NEW1_YEAST | NEW1 | genetic | 27708008 | |
| UBA3_YEAST | UBA3 | genetic | 27708008 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...